TNNT3 (NM_001042782) Human Tagged ORF Clone

CAT#: RG223893

  • TrueORF®

TNNT3 (tGFP-tagged) - Human troponin T type 3 (skeletal, fast) (TNNT3), transcript variant 4

ORF Plasmid: DDK tGFP



  "NM_001042782" in other vectors (4)

Need custom modification / cloning service?
Get a free quote

CNY 4,000.00

CNY 4,370.00


货期*
现货

规格
    • 10 ug

Product images

经常一起买 (5)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

CNY 6,080.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

CNY 1,000.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


Rabbit Polyclonal Anti-TNNT3
    • 50 ug

CNY 4,628.00

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Synonyms beta-TnTF; DA2B2; TNTF
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG223893 representing NM_001042782
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCTGACGAGGAAGTTGAACAGGTGGAGGAGCAGTACGAAGAAGAAGAGGAAGCCCAGGAGGAAGAGG
AAGTTCAAGAAGAGGAGAAACCGAGACCCAAACTCACTGCTCCTAAGATCCCAGAAGGGGAGAAAGTGGA
CTTCGATGACATCCAGAAGAAGCGTCAGAACAAAGACCTAATGGAGCTCCAGGCCCTCATCGACAGCCAC
TTTGAAGCCCGGAAGAAGGAGGAGGAGGAGCTGGTCGCTCTCAAAGAGAGAATCGAGAAGCGCCGTGCAG
AGAGAGCGGAGCAGCAGAGGATTCGTGCAGAGAAGGAGAGGGAGCGCCAGAACAGACTGGCGGAGGAAAA
GGCCAGAAGGGAGGAGGAGGATGCCAAGAGGAGGGCAGAGGACGACCTGAAGAAGAAGAAAGCTCTGTCT
TCCATGGGAGCCAACTACAGCAGCTACCTGGCCAAGGCTGACCAGAAGAGAGGCAAGAAGCAGACAGCCC
GGGAAATGAAGAAGAAGATTCTGGCTGAGAGACGCAAGCCGCTCAACATCGATCACCTTGGTGAAGACAA
ACTGAGGGACAAGGCCAAGGAGCTCTGGGAGACCCTGCACCAGCTGGAGATTGACAAGTTCGAGTTTGGG
GAGAAGCTGAAACGCCAGAAATATGACATCACCACGCTCAGGAGCCGCATTGACCAGGCCCAGAAGCACA
GCAAGAAGGCTGGGACCCCAGCCAAGGGCAAAGTCGGCGGGCGCTGGAAG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG223893 representing NM_001042782
Red=Cloning site Green=Tags(s)

MSDEEVEQVEEQYEEEEEAQEEEEVQEEEKPRPKLTAPKIPEGEKVDFDDIQKKRQNKDLMELQALIDSH
FEARKKEEEELVALKERIEKRRAERAEQQRIRAEKERERQNRLAEEKARREEEDAKRRAEDDLKKKKALS
SMGANYSSYLAKADQKRGKKQTAREMKKKILAERRKPLNIDHLGEDKLRDKAKELWETLHQLEIDKFEFG
EKLKRQKYDITTLRSRIDQAQKHSKKAGTPAKGKVGGRWK

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001042782
ORF Size 750 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001042782.3
RefSeq Size 987 bp
RefSeq ORF 753 bp
Locus ID 7140
UniProt ID P45378
Gene Summary The binding of Ca(2+) to the trimeric troponin complex initiates the process of muscle contraction. Increased Ca(2+) concentrations produce a conformational change in the troponin complex that is transmitted to tropomyosin dimers situated along actin filaments. The altered conformation permits increased interaction between a myosin head and an actin filament which, ultimately, produces a muscle contraction. The troponin complex has protein subunits C, I, and T. Subunit C binds Ca(2+) and subunit I binds to actin and inhibits actin-myosin interaction. Subunit T binds the troponin complex to the tropomyosin complex and is also required for Ca(2+)-mediated activation of actomyosin ATPase activity. There are 3 different troponin T genes that encode tissue-specific isoforms of subunit T for fast skeletal-, slow skeletal-, and cardiac-muscle. This gene encodes fast skeletal troponin T protein; also known as troponin T type 3. Alternative splicing results in multiple transcript variants encoding additional distinct troponin T type 3 isoforms. A developmentally regulated switch between fetal/neonatal and adult troponin T type 3 isoforms occurs. Additional splice variants have been described but their biological validity has not been established. Mutations in this gene may cause distal arthrogryposis multiplex congenita type 2B (DA2B). [provided by RefSeq, Oct 2009]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...