AP1S3 (NM_001039569) Human Tagged ORF Clone

CAT#: RG220329

  • TrueORF®

AP1S3 (tGFP-tagged) - Human adaptor-related protein complex 1, sigma 3 subunit (AP1S3)

ORF Plasmid: DDK tGFP



  "NM_001039569" in other vectors (4)

Need custom modification / cloning service?
Get a free quote

CNY 4,370.00


货期*
4周

规格
    • 10 ug

Product images

经常一起买 (5)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

CNY 6,080.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

CNY 1,000.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


AP1S3 rabbit polyclonal antibody
    • 100 ul

CNY 1,999.00
CNY 3,280.00

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Synonyms PSORS15; sigma1C
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG220329 representing NM_001039569
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATACATTTCATATTGCTCTTCAGTCGACAAGGGAAATTACGGCTACAGAAATGGTACATCACTCTCC
CTGATAAAGAGAGGAAGAAGATCACCCGGGAAATTGTTCAGATTATTCTCTCCCGTGGTCACAGGACAAG
CAGTTTTGTTGACTGGAAGGAGCTAAAACTTGTTTATAAAAGGTATGCTAGTTTATATTTTTGCTGTGCA
ATAGAAAATCAGGACAATGAGCTCTTGACGCTAGAGATTGTGCATCGTTACGTGGAGCTGCTGGACAAAT
ATTTTGGAAATGTCTGTGAGCTGGATATTATCTTTAATTTTGAAAAGGCTTATTTCATCCTGGACGAGTT
TATAATAGGTGGGGAAATTCAGGAAACATCCAAGAAAATTGCTGTCAAAGCCATTGAAGACTCTGATATG
TTACAGGAGACAATGGAAGAATACATGAACAAGCCTACATTT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG220329 representing NM_001039569
Red=Cloning site Green=Tags(s)

MIHFILLFSRQGKLRLQKWYITLPDKERKKITREIVQIILSRGHRTSSFVDWKELKLVYKRYASLYFCCA
IENQDNELLTLEIVHRYVELLDKYFGNVCELDIIFNFEKAYFILDEFIIGGEIQETSKKIAVKAIEDSDM
LQETMEEYMNKPTF

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001039569
ORF Size 462 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001039569.2
RefSeq Size 4005 bp
RefSeq ORF 465 bp
Locus ID 130340
UniProt ID Q96PC3
Protein Pathways Lysosome
Gene Summary This gene encodes a member of the adaptor-related protein complex 1, sigma subunit genes. The encoded protein is a component of adaptor protein complex 1 (AP-1), one of the AP complexes involved in claathrin-mediated vesicular transport from the Golgi or endosomes. Disruption of the pathway for display of HIV-1 antigens, which prevents recognition of the virus by cytotoxic T cells, has been shown to involve the AP-1 complex (PMID: 15569716). Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2014]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...