ALIX (PDCD6IP) (NM_001256192) Human Tagged ORF Clone

CAT#: RC232346

  • TrueORF®

PDCD6IP (Myc-DDK tagged) - Homo sapiens programmed cell death 6 interacting protein (PDCD6IP), transcript variant 4

ORF Plasmid: DDK tGFP



  "NM_001256192" in other vectors (2)

Need custom modification / cloning service?
Get a free quote

CNY 3,990.00


货期*
4周

规格
    • 10 ug

Product images

经常一起买 (4)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00


PDCD6IP mouse monoclonal antibody, clone OTI1A4 (formerly 1A4)
    • 100 ul

CNY 1,999.00
CNY 2,700.00

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Synonyms AIP1; ALIX; DRIP4; HP95
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC232346 representing NM_001256192
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGACATTCATCTCGGTGCAGCTGAAAAAGACCTCAGAGGTGGACCTGGCCAAGCCGCTGGTGAAGT
TCATCCAGCAGACTTACCCAAGCGGCGGGGAAGAGCAGGCCCAGTACTGCCGCGCGGCGGAGGAGCTCAG
CAAGCTGCGCCGCGCCGCAGTCGGTCGTCCGCTGGACAAGCACGAGGGCGCGCTCGAGACGCTCCTGAGA
TATTATGATCAGATTTGTTCTATTGAACCCAAATTCCCATTTTCTGAAAATCAGATCTGCTTGACATTTA
CCTGGAAGGATGCTTTCGATAAAGGTTCACTTTTTGGAGGCTCTGTAAAACTGGCTCTTGCAAGCTTAGG
ATATGAAAAGAGCTGTGTGTTGTTCAATTGTGCAGCCTTAGCTAGCCAAATTGCAGCAGAACAGAACCTG
GATAATGATGAAGGATTGAAAATCGCTGCTAAACATTACCAGTTTGCTAGTGGTGCCTTTTTACATATTA
AAGAGACGGTTTTATCTGCCTTAAGTCGAGAGCCGACCGTGGACATATCTCCAGATACTGTTGGGACCCT
CAGTCTTATTATGCTGGCACAGGCTCAAGAAGTATTTTTTTTAAAAGCCACAAGAGATAAAATGAAAGAT
GCCATCATAGCTAAATTGGCTAATCAGGCTGCAGATTATTTTGGTGATGCTTTCAAACAGTGTCAATACA
AAGATACTCTCCCCAAGGTCAGTTATTGTTTTTATAAACACTTGCTTACTTTGCATGTGAAATATTTAGA
CTTTTTTGTGTATAAGAAGCAAGTTGAAACTTATAAAGAAATT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC232346 representing NM_001256192
Red=Cloning site Green=Tags(s)

MATFISVQLKKTSEVDLAKPLVKFIQQTYPSGGEEQAQYCRAAEELSKLRRAAVGRPLDKHEGALETLLR
YYDQICSIEPKFPFSENQICLTFTWKDAFDKGSLFGGSVKLALASLGYEKSCVLFNCAALASQIAAEQNL
DNDEGLKIAAKHYQFASGAFLHIKETVLSALSREPTVDISPDTVGTLSLIMLAQAQEVFFLKATRDKMKD
AIIAKLANQAADYFGDAFKQCQYKDTLPKVSYCFYKHLLTLHVKYLDFFVYKKQVETYKEI

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001256192
ORF Size 813 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001256192.1, NP_001243121.1
RefSeq Size 1569 bp
RefSeq ORF 816 bp
Locus ID 10015
UniProt ID Q8WUM4
Protein Families Druggable Genome
Protein Pathways Endocytosis
MW 30.9 kDa
Gene Summary This gene encodes a protein that functions within the ESCRT pathway in the abscission stage of cytokinesis, in intralumenal endosomal vesicle formation, and in enveloped virus budding. Studies using mouse cells have shown that overexpression of this protein can block apoptosis. In addition, the product of this gene binds to the product of the PDCD6 gene, a protein required for apoptosis, in a calcium-dependent manner. This gene product also binds to endophilins, proteins that regulate membrane shape during endocytosis. Overexpression of this gene product and endophilins results in cytoplasmic vacuolization, which may be partly responsible for the protection against cell death. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene. Related pseudogenes have been identified on chromosome 15. [provided by RefSeq, Jan 2012]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...