IL24 (NM_001185158) Human Tagged ORF Clone
CAT#: RC230916
- TrueORF®
IL24 (Myc-DDK-tagged)-Human interleukin 24 (IL24), transcript variant 5
ORF Plasmid: tGFP
"NM_001185158" in other vectors (3)
Need custom modification / cloning service?
Get a free quote
CNY 3,990.00
CNY 300.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | C49A; FISP; IL10B; MDA7; MOB5; ST16 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC230916 representing NM_001185158
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGAATTTTCAACAGAGGCTGCAAAGCCTGTGGACTTTAGCCAGCAAGCTCAGGATAACATCACGAGTGC CCGGCTGCTGCAGCAGGAGGTTCTGCAGAACGTCTCGCAAGAAAATGAGATGTTTTCCATCAGAGACAGT GCACACAGGCGGTTTCTGCTATTCCGGAGAGCATTCAAACAGTTGGACG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC230916 representing NM_001185158
Red=Cloning site Green=Tags(s) MNFQQRLQSLWTLASKLRITSRVPGCCSRRFCRTSRKKMRCFPSETVHTGGFCYSGEHSNSWT myc-FLAG tag |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_001185158 |
ORF Size | 189 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_001185158.1, NP_001172087.1 |
RefSeq ORF | 192 bp |
Locus ID | 11009 |
UniProt ID | Q13007 |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway |
MW | 7.8 kDa |
Gene Summary | This gene encodes a member of the IL10 family of cytokines. It was identified as a gene induced during terminal differentiation in melanoma cells. The protein encoded by this gene can induce apoptosis selectively in various cancer cells. Overexpression of this gene leads to elevated expression of several GADD family genes, which correlates with the induction of apoptosis. The phosphorylation of mitogen-activated protein kinase 14 (MAPK7/P38), and heat shock 27kDa protein 1 (HSPB2/HSP27) are found to be induced by this gene in melanoma cells, but not in normal immortal melanocytes. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC230916L3 | Lenti-ORF clone of IL24 (Myc-DDK-tagged)-Human interleukin 24 (IL24), transcript variant 5 |
CNY 5,890.00 |
|
RC230916L4 | Lenti-ORF clone of IL24 (mGFP-tagged)-Human interleukin 24 (IL24), transcript variant 5 |
CNY 5,890.00 |
|
RG230916 | IL24 (tGFP-tagged) - Human interleukin 24 (IL24), transcript variant 5 |
CNY 4,370.00 |