TRAF1 (NM_001190947) Human Tagged ORF Clone

CAT#: RC230797

  • TrueORF®

TRAF1 (Myc-DDK-tagged)-Human TNF receptor-associated factor 1 (TRAF1), transcript variant 3

ORF Plasmid: DDK tGFP



  "NM_001190947" in other vectors (3)

Need custom modification / cloning service?
Get a free quote

CNY 3,990.00


货期*
3周

规格
    • 10 ug

Product images

经常一起买 (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00


Anti-TRAF1 Rabbit Polyclonal Antibody
    • 100 ul

CNY 1,999.00
CNY 3,280.00

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Synonyms EBI6; MGC:10353
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC230797 representing NM_001190947
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAACAGTGGAAGGCCCGGCTGGGCTGTGGCCTGGAGTCTGGGCCCATGGCCCTGGAGCAGAACCTGT
CAGACCTGCAGCTGCAGGCAGCCGTGGAAGTGGCGGGGGACCTGGAGGTCGATTGCTACCGGGCACCCTG
CTCCGAGAGCCAGGAGGAGCTGGCCCTGCAGCACTTCATGAAGGAGAAGCTTCTGGCTGAGCTGGAGGGG
AAGCTGCGTGTGTTTGAGAACATTGTTGCTGTCCTCAACAAGGAGGTGGAGGCCTCCCACCTGGCCCTGG
CCACCTCTATCCACCAGAGCCAGCTGGACCGTGAGCGCATCCTGAGCTTGGAGCAGAGGGTGGTGGAGCT
TCAGCAGACCCTGGCCCAGAAAGACCAGGCCCTGGGCAAGCTGGAGCAGAGCTTGCGCCTCATGGAGGAG
GCCTCCTTCGATGGCACTTTCCTGTGGAAGATCACCAATGTCACCAGGCGGTGCCATGAGTCGGCCTGTG
GCAGGACCGTCAGCCTCTTCTCCCCAGCCTTCTACACTGCCAAGTATGGCTACAAGTTGTGCCTGCGGCT
GTACCTGAATGGAGATGGCACTGGAAAGAGAACCCATCTGTCGCTCTTCATCGTGATCATGAGAGGGGAG
TATGATGCGCTGCTGCCGTGGCCCTTCCGGAACAAGGTCACCTTCATGCTGCTGGACCAGAACAACCGTG
AGCACGCCATTGACGCCTTCCGGCCTGACCTAAGCTCAGCGTCCTTCCAGAGGCCCCAGAGTGAAACCAA
CGTGGCCAGTGGATGCCCACTCTTCTTCCCCCTCAGCAAACTGCAGTCACCCAAGCACGCCTACGTGAAG
GACGACACAATGTTCCTCAAGTGCATTGTGGAGACCAGCACT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC230797 representing NM_001190947
Red=Cloning site Green=Tags(s)

MKQWKARLGCGLESGPMALEQNLSDLQLQAAVEVAGDLEVDCYRAPCSESQEELALQHFMKEKLLAELEG
KLRVFENIVAVLNKEVEASHLALATSIHQSQLDRERILSLEQRVVELQQTLAQKDQALGKLEQSLRLMEE
ASFDGTFLWKITNVTRRCHESACGRTVSLFSPAFYTAKYGYKLCLRLYLNGDGTGKRTHLSLFIVIMRGE
YDALLPWPFRNKVTFMLLDQNNREHAIDAFRPDLSSASFQRPQSETNVASGCPLFFPLSKLQSPKHAYVK
DDTMFLKCIVETST

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001190947
ORF Size 882 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001190947.1, NP_001177876.1
RefSeq Size 3715 bp
RefSeq ORF 885 bp
Locus ID 7185
UniProt ID Q13077
Protein Families Druggable Genome
Protein Pathways Pathways in cancer, Small cell lung cancer
MW 33.3 kDa
Gene Summary The protein encoded by this gene is a member of the TNF receptor (TNFR) associated factor (TRAF) protein family. TRAF proteins associate with, and mediate the signal transduction from various receptors of the TNFR superfamily. This protein and TRAF2 form a heterodimeric complex, which is required for TNF-alpha-mediated activation of MAPK8/JNK and NF-kappaB. The protein complex formed by this protein and TRAF2 also interacts with inhibitor-of-apoptosis proteins (IAPs), and thus mediates the anti-apoptotic signals from TNF receptors. The expression of this protein can be induced by Epstein-Barr virus (EBV). EBV infection membrane protein 1 (LMP1) is found to interact with this and other TRAF proteins; this interaction is thought to link LMP1-mediated B lymphocyte transformation to the signal transduction from TNFR family receptors. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jul 2010]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...