CDK1 (NM_001170406) Human Tagged ORF Clone
CAT#: RC229540
- TrueORF®
CDK1 (Myc-DDK-tagged)-Human cyclin-dependent kinase 1 (CDK1), transcript variant 4
ORF Plasmid: tGFP
"NM_001170406" in other vectors (4)
Need custom modification / cloning service?
Get a free quote
CNY 3,990.00
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | CDC2; CDC28A; P34CDC2 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC229540 representing NM_001170406
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGAAGATTATACCAAAATAGAGAAAATTGGAGAAGGTACCTATGGAGTTGTGTATAAGGGTAGACACA AAACTACAGGTCAAGTGGTAGCCATGAAAAAAATCAGACTAGAAAGTGAAGAGGAAGGGGTTCCTAGTAC TGCAATTCGGGAAATTTCTCTATTAAAGGAACTTCGTCATCCAAATATAGTCAGTCTTCAGGATGTGCTT ATGCAGGATTCCAGGTTATATCTCATCTTTGAGTTTCTTTCCATGGATCTGAAGAAATACTTGGATTCTA TCCCTCCTGGTCAGTACATGGATTCTTCACTTGTTAAGGTAAAAGCT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC229540 representing NM_001170406
Red=Cloning site Green=Tags(s) MEDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKELRHPNIVSLQDVL MQDSRLYLIFEFLSMDLKKYLDSIPPGQYMDSSLVKVKA myc-FLAG tag |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_001170406 |
ORF Size | 327 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_001170406.1, NP_001163877.1 |
RefSeq ORF | 330 bp |
Locus ID | 983 |
Protein Families | Druggable Genome, Protein Kinase, Stem cell - Pluripotency |
Protein Pathways | Cell cycle, Gap junction, Oocyte meiosis, p53 signaling pathway, Progesterone-mediated oocyte maturation |
MW | 12.9 kDa |
Gene Summary | The protein encoded by this gene is a member of the Ser/Thr protein kinase family. This protein is a catalytic subunit of the highly conserved protein kinase complex known as M-phase promoting factor (MPF), which is essential for G1/S and G2/M phase transitions of eukaryotic cell cycle. Mitotic cyclins stably associate with this protein and function as regulatory subunits. The kinase activity of this protein is controlled by cyclin accumulation and destruction through the cell cycle. The phosphorylation and dephosphorylation of this protein also play important regulatory roles in cell cycle control. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2009] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC229540L3 | Lenti-ORF clone of CDK1 (Myc-DDK-tagged)-Human cyclin-dependent kinase 1 (CDK1), transcript variant 4 |
CNY 5,890.00 |
|
RC229540L4 | Lenti-ORF clone of CDK1 (mGFP-tagged)-Human cyclin-dependent kinase 1 (CDK1), transcript variant 4 |
CNY 5,890.00 |
|
RG229540 | CDK1 (tGFP-tagged) - Human cyclin-dependent kinase 1 (CDK1), transcript variant 4 |
CNY 4,370.00 |
|
SC328178 | CDK1 (untagged)-Human cyclin-dependent kinase 1 (CDK1) transcript variant 4 |
CNY 3,990.00 |