splicing factor 1 (SF1) (NM_201997) Human Tagged ORF Clone
CAT#: RC223837
SF1 (Myc-DDK-tagged)-Human splicing factor 1 (SF1), transcript variant 4
ORF Plasmid: tGFP
"NM_201997" in other vectors (4)
Need custom modification / cloning service?
Get a free quote
CNY 1,200.00
CNY 3,990.00
CNY 300.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | BBP; D11S636; MBBP; ZCCHC25; ZFM1; ZNF162 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC223837 representing NM_201997
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCGACCGGAGCGAACGCCACGCCGTTGGACTTCCCAAGTAAGAAGCGGAAGAGGAGCCGCTGGAACC AAGACACAATGGAACAGAAGACAGTGATTCCAGGAATGCCTACAGTTATTCCCCCTGGACTTACTCGAGA ACAAGAAAGAGCTTATATAGGTAAATATACGTTCTGCATCCAAATGCACTTTGAGATTGTTACGATTTAT TCTGAGCAAGATCTGCATTTTTTGAAAGTT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC223837 representing NM_201997
Red=Cloning site Green=Tags(s) MATGANATPLDFPSKKRKRSRWNQDTMEQKTVIPGMPTVIPPGLTREQERAYIGKYTFCIQMHFEIVTIY SEQDLHFLKV myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_201997 |
ORF Size | 240 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_201997.1, NP_973726.1 |
RefSeq Size | 1001 bp |
RefSeq ORF | 1716 bp |
Locus ID | 7536 |
Protein Families | Transcription Factors |
MW | 9.1 kDa |
Gene Summary | This gene encodes a nuclear pre-mRNA splicing factor. The encoded protein specifically recognizes the intron branch point sequence at the 3' splice site, together with the large subunit of U2 auxiliary factor (U2AF), and is required for the early stages of spliceosome assembly. It also plays a role in nuclear pre-mRNA retention and transcriptional repression. The encoded protein contains an N-terminal U2AF ligand motif, a central hnRNP K homology motif and quaking 2 region which bind a key branch-site adenosine within the branch point sequence, a zinc knuckles domain, and a C-terminal proline-rich domain. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2016] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC223837L3 | Lenti ORF clone of Human splicing factor 1 (SF1), transcript variant 4, Myc-DDK-tagged |
CNY 5,890.00 |
|
RC223837L4 | Lenti ORF clone of Human splicing factor 1 (SF1), transcript variant 4, mGFP tagged |
CNY 5,890.00 |
|
RG223837 | SF1 (tGFP-tagged) - Human splicing factor 1 (SF1), transcript variant 4 |
CNY 2,800.00 |
|
SC121559 | SF1 (untagged)-Human splicing factor 1 (SF1), transcript variant 4 |
CNY 1,200.00 |
其它splicing factor 1产品