ARPC4 (NM_001024959) Human Tagged ORF Clone
CAT#: RC218150
- TrueORF®
ARPC4 (Myc-DDK-tagged)-Human actin related protein 2/3 complex, subunit 4, 20kDa (ARPC4), transcript variant 2
ORF Plasmid: tGFP
"NM_001024959" in other vectors (4)
Need custom modification / cloning service?
Get a free quote
CNY 3,990.00
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | ARC20; P20-ARC |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC218150 representing NM_001024959
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGCGCTTCATGATGATGCGAGCAGAGAACTTCTTTATCCTTCGAAGGAAGCCTGTGGAGGGGTATGATA TCAGCTTTCTGATCACCAACTTCCACACAGAGCAGATGTACAAACACAAGTTGGTGGACTTTGTGATCCA CTTCATGGAGGAGATTGACAAGGAGATCAGTGAGATGAAGCTGTCAGTCAATGCCCGTGCCCGCATTGTG GCTGAAGAGTTCCTTAAGAATTTT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC218150 representing NM_001024959
Red=Cloning site Green=Tags(s) MRFMMMRAENFFILRRKPVEGYDISFLITNFHTEQMYKHKLVDFVIHFMEEIDKEISEMKLSVNARARIV AEEFLKNF myc-FLAG tag |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_001024959 |
ORF Size | 234 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_001024959.2, NP_001020130.1 |
RefSeq Size | 1622 bp |
RefSeq ORF | 237 bp |
Locus ID | 10093 |
UniProt ID | P59998 |
Protein Pathways | Fc gamma R-mediated phagocytosis, Pathogenic Escherichia coli infection, Regulation of actin cytoskeleton |
MW | 9.6 kDa |
Gene Summary | This gene encodes one of seven subunits of the human Arp2/3 protein complex. This complex controls actin polymerization in cells and has been conserved throughout eukaryotic evolution. This gene encodes the p20 subunit, which is necessary for actin nucleation and high-affinity binding to F-actin. Alternative splicing results in multiple transcript variants. Naturally occurring read-through transcription exists between this gene and the downstream tubulin tyrosine ligase-like family, member 3 (TTLL3), which results in the production of a fusion protein. [provided by RefSeq, Nov 2010] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC218150L3 | Lenti-ORF clone of ARPC4 (Myc-DDK-tagged)-Human actin related protein 2/3 complex, subunit 4, 20kDa (ARPC4), transcript variant 2 |
CNY 5,890.00 |
|
RC218150L4 | Lenti-ORF clone of ARPC4 (mGFP-tagged)-Human actin related protein 2/3 complex, subunit 4, 20kDa (ARPC4), transcript variant 2 |
CNY 5,890.00 |
|
RG218150 | ARPC4 (tGFP-tagged) - Human actin related protein 2/3 complex, subunit 4, 20kDa (ARPC4), transcript variant 2 |
CNY 4,370.00 |
|
SC302329 | ARPC4 (untagged)-Human actin related protein 2/3 complex, subunit 4, 20kDa (ARPC4), transcript variant 2 |
CNY 3,990.00 |