BDNF (NM_170735) Human Tagged ORF Clone
CAT#: RC217190
BDNF (Myc-DDK-tagged)-Human brain-derived neurotrophic factor (BDNF), transcript variant 1
ORF Plasmid: tGFP
"NM_170735" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 3,600.00
CNY 3,705.00
Cited in 3 publications. |
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | ANON2; BULN2 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC217190 representing NM_170735
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGACCATCCTTTTCCTTACTATGGTTATTTCATACTTTGGTTGCATGAAGGCTGCCCCCATGAAAGAAG CAAACATCCGAGGACAAGGTGGCTTGGCCTACCCAGGTGTGCGGACCCATGGGACTCTGGAGAGCGTGAA TGGGCCCAAGGCAGGTTCAAGAGGCTTGACATCATTGGCTGACACTTTCGAACACGTGATAGAAGAGCTG TTGGATGAGGACCAGAAAGTTCGGCCCAATGAAGAAAACAATAAGGACGCAGACTTGTACACGTCCAGGG TGATGCTCAGTAGTCAAGTGCCTTTGGAGCCTCCTCTTCTCTTTCTGCTGGAGGAATACAAAAATTACCT AGATGCTGCAAACATGTCCATGAGGGTCCGGCGCCACTCTGACCCTGCCCGCCGAGGGGAGCTGAGCGTG TGTGACAGTATTAGTGAGTGGGTAACGGCGGCAGACAAAAAGACTGCAGTGGACATGTCGGGCGGGACGG TCACAGTCCTTGAAAAGGTCCCTGTATCAAAAGGCCAACTGAAGCAATACTTCTACGAGACCAAGTGCAA TCCCATGGGTTACACAAAAGAAGGCTGCAGGGGCATAGACAAAAGGCATTGGAACTCCCAGTGCCGAACT ACCCAGTCGTACGTGCGGGCCCTTACCATGGATAGCAAAAAGAGAATTGGCTGGCGATTCATAAGGATAG ACACTTCTTGTGTATGTACATTGACCATTAAAAGGGGAAGA ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC217190 representing NM_170735
Red=Cloning site Green=Tags(s) MTILFLTMVISYFGCMKAAPMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLADTFEHVIEEL LDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGELSV CDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRT TQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_170735 |
ORF Size | 741 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_170735.5 |
RefSeq Size | 4247 bp |
RefSeq ORF | 744 bp |
Locus ID | 627 |
UniProt ID | P23560 |
Protein Families | Adult stem cells, Druggable Genome, Embryonic stem cells, ES Cell Differentiation/IPS, Induced pluripotent stem cells, Secreted Protein, Transmembrane |
Protein Pathways | Huntington's disease, MAPK signaling pathway, Neurotrophin signaling pathway |
MW | 25.7 kDa |
Gene Summary | This gene encodes a member of the nerve growth factor family of proteins. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate the mature protein. Binding of this protein to its cognate receptor promotes neuronal survival in the adult brain. Expression of this gene is reduced in Alzheimer's, Parkinson's, and Huntington's disease patients. This gene may play a role in the regulation of the stress response and in the biology of mood disorders. [provided by RefSeq, Nov 2015] |
Citations (3)
The use of this cDNA Clones has been cited in the following citations: |
---|
Sustained adrenergic signaling promotes intratumoral innervation through BDNF induction
,Allen, JK;Armaiz-Pena, GN;Nagaraja, AS;Sadaoui, NC;Ortiz, T;Dood, R;Ozcan, M;Herder, DM;Haemerrle, M;Gharpure, KM;Rupaimoole, R;Previs, R;Wu, SY;Pradeep, S;Xu, X;Dong Han, H;Zand, B;Dalton, HJ;Taylor, M;Hu, W;Bottsford-Miller, J;Moreno-Smith, M;Kang, Y;Mangala, LS;Rodriguez-Aguayo, C;Sehgal, V;Spaeth, EL;Ram, PT;Wong, ST;Marini, FC;Lopez-Berestein, G;Cole, SW;Lutgendorf, SK;diBiasi, M;Sood, AK;,
Cancer Res.
,PubMed ID 29661830
[BDNF]
|
MicroRNA‑744 inhibits tumor cell proliferation and invasion of gastric cancer via targeting brain‑derived neurotrophic factor
,Xu, AJ;Fu, LN;Wu, HX;Yao, XL;Meng, R;,
Mol Med Rep
,PubMed ID 28791400
[BDNF]
|
In vitro bioassay model for screening non-viral neurotrophic factor gene delivery systems for glaucoma treatment
,Chen, DW;Foldvari, M;,
Drug Deliv Transl Res
,PubMed ID 27549107
[BDNF]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC217190L1 | Lenti ORF clone of Human brain-derived neurotrophic factor (BDNF), transcript variant 1, Myc-DDK-tagged |
CNY 6,000.00 |
|
RC217190L2 | Lenti ORF clone of Human brain-derived neurotrophic factor (BDNF), transcript variant 1, mGFP tagged |
CNY 6,000.00 |
|
RC217190L3 | Lenti ORF clone of Human brain-derived neurotrophic factor (BDNF), transcript variant 1, Myc-DDK-tagged |
CNY 6,000.00 |
|
RC217190L4 | Lenti ORF clone of Human brain-derived neurotrophic factor (BDNF), transcript variant 1, mGFP tagged |
CNY 6,000.00 |
|
RG217190 | BDNF (tGFP-tagged) - Human brain-derived neurotrophic factor (BDNF), transcript variant 1 |
CNY 5,200.00 |
|
SC309453 | BDNF (untagged)-Human brain-derived neurotrophic factor (BDNF), transcript variant 1 |
CNY 3,600.00 |