GNG13 (NM_016541) Human Tagged ORF Clone
CAT#: RC210828
GNG13 (Myc-DDK-tagged)-Human guanine nucleotide binding protein (G protein), gamma 13 (GNG13)
ORF Plasmid: tGFP
"NM_016541" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 1,200.00
CNY 3,705.00
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | G(gamma)13; h2-35 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC210828 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGAGGAGTGGGACGTGCCACAGATGAAGAAAGAGGTGGAGAGCCTCAAGTACCAGCTGGCCTTCCAGC GGGAGATGGCGTCCAAGACCATCCCCGAGCTGCTGAAGTGGATCGAGGACGGGATCCCCAAGGACCCCTT CCTGAACCCCGACCTGATGAAGAACAACCCATGGGTGGAAAAGGGCAAATGCACCATCCTG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC210828 protein sequence
Red=Cloning site Green=Tags(s) MEEWDVPQMKKEVESLKYQLAFQREMASKTIPELLKWIEDGIPKDPFLNPDLMKNNPWVEKGKCTIL myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_016541 |
ORF Size | 201 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_016541.3 |
RefSeq Size | 1001 bp |
RefSeq ORF | 204 bp |
Locus ID | 51764 |
UniProt ID | Q9P2W3 |
Protein Families | Druggable Genome |
Protein Pathways | Chemokine signaling pathway, Taste transduction |
MW | 7.9 kDa |
Gene Summary | Heterotrimeric G proteins, which consist of alpha (see MIM 139320), beta (see MIM 139380), and gamma subunits, function as signal transducers for the 7-transmembrane-helix G protein-coupled receptors. GNG13 is a gamma subunit that is expressed in taste, retinal, and neuronal tissues and plays a key role in taste transduction (Li et al., 2006 [PubMed 16473877]).[supplied by OMIM, Oct 2009] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC210828L1 | Lenti ORF clone of Human guanine nucleotide binding protein (G protein), gamma 13 (GNG13), Myc-DDK-tagged |
CNY 3,600.00 |
|
RC210828L2 | Lenti ORF clone of Human guanine nucleotide binding protein (G protein), gamma 13 (GNG13), mGFP tagged |
CNY 5,890.00 |
|
RC210828L3 | Lenti ORF clone of Human guanine nucleotide binding protein (G protein), gamma 13 (GNG13), Myc-DDK-tagged |
CNY 5,890.00 |
|
RC210828L4 | Lenti ORF clone of Human guanine nucleotide binding protein (G protein), gamma 13 (GNG13), mGFP tagged |
CNY 5,890.00 |
|
RG210828 | GNG13 (tGFP-tagged) - Human guanine nucleotide binding protein (G protein), gamma 13 (GNG13) |
CNY 2,800.00 |
|
SC125264 | GNG13 (untagged)-Human guanine nucleotide binding protein (G protein), gamma 13 (GNG13) |
CNY 1,200.00 |