Caveolin 1 (CAV1) (NM_001753) Human Tagged ORF Clone
CAT#: RC210274
CAV1 (Myc-DDK-tagged)-Human caveolin 1, caveolae protein, 22kDa (CAV1), transcript variant 1
ORF Plasmid: tGFP
"NM_001753" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 2,400.00
CNY 3,705.00
Cited in 10 publications. |
CNY 300.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | BSCL3; CGL3; LCCNS; MSTP085; PPH3; VIP21 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC210274 representing NM_001753
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGTCTGGGGGCAAATACGTAGACTCGGAGGGACATCTCTACACCGTTCCCATCCGGGAACAGGGCAACA TCTACAAGCCCAACAACAAGGCCATGGCAGACGAGCTGAGCGAGAAGCAAGTGTACGACGCGCACACCAA GGAGATCGACCTGGTCAACCGCGACCCTAAACACCTCAACGATGACGTGGTCAAGATTGACTTTGAAGAT GTGATTGCAGAACCAGAAGGGACACACAGTTTTGACGGCATTTGGAAGGCCAGCTTCACCACCTTCACTG TGACGAAATACTGGTTTTACCGCTTGCTGTCTGCCCTCTTTGGCATCCCGATGGCACTCATCTGGGGCAT TTACTTCGCCATTCTCTCTTTCCTGCACATCTGGGCAGTTGTACCATGCATTAAGAGCTTCCTGATTGAG ATTCAGTGCATCAGCCGTGTCTATTCCATCTACGTCCACACCGTCTGTGACCCACTCTTTGAAGCTGTTG GGAAAATATTCAGCAATGTCCGCATCAACTTGCAGAAAGAAATA ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC210274 representing NM_001753
Red=Cloning site Green=Tags(s) MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFED VIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIE IQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_001753 |
ORF Size | 534 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_001753.5 |
RefSeq Size | 2704 bp |
RefSeq ORF | 537 bp |
Locus ID | 857 |
UniProt ID | Q03135 |
Domains | Caveolin |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Focal adhesion, Viral myocarditis |
MW | 20.3 kDa |
Gene Summary | The scaffolding protein encoded by this gene is the main component of the caveolae plasma membranes found in most cell types. The protein links integrin subunits to the tyrosine kinase FYN, an initiating step in coupling integrins to the Ras-ERK pathway and promoting cell cycle progression. The gene is a tumor suppressor gene candidate and a negative regulator of the Ras-p42/44 mitogen-activated kinase cascade. Caveolin 1 and caveolin 2 are located next to each other on chromosome 7 and express colocalizing proteins that form a stable hetero-oligomeric complex. Mutations in this gene have been associated with Berardinelli-Seip congenital lipodystrophy. Alternatively spliced transcripts encode alpha and beta isoforms of caveolin 1.[provided by RefSeq, Mar 2010] |
Citations (10)
The use of this cDNA Clones has been cited in the following citations: |
---|
The RNA-binding protein HuR regulates intestinal epithelial restitution by modulating Caveolin-1 gene expression
,Cao, S;Xiao, L;Wang, J;Chen, G;Liu, Y;,
The Biochemical journal
,PubMed ID 33346337
[Caveolin 1]
|
SMPDL3b modulates insulin receptor signaling in diabetic kidney disease
,Mitrofanova, A;Mallela, SK;Ducasa, GM;Yoo, TH;Rosenfeld-Gur, E;Zelnik, ID;Molina, J;Varona Santos, J;Ge, M;Sloan, A;Kim, JJ;Pedigo, C;Bryn, J;Volosenco, I;Faul, C;Zeidan, YH;Garcia Hernandez, C;Mendez, AJ;Leibiger, I;Burke, GW;Futerman, AH;Barisoni, L;Ishimoto, Y;Inagi, R;Merscher, S;Fornoni, A;,
Nat Commun
,PubMed ID 31217420
[Caveolin 1]
|
Dipeptidyl peptidase-4 plays a pathogenic role in BSA-induced kidney injury in diabetic mice
,Takagaki, Y;Shi, S;Katoh, M;Kitada, M;Kanasaki, K;Koya, D;,
Sci Rep
,PubMed ID 31101909
[Caveolin 1]
|
Cav-1 Upregulation Slows Migration Velocity in BLM Melanoma
,Kinsey, SS;w Baer, R;,
The FASEB Journal
[Caveolin 1]
|
Real-time imaging of sodium glucose transporter (SGLT1) trafficking and activity in single cells
,Ghezzi, C;Calmettes, G;Morand, P;Ribalet, B;John, S;,
Physiol Rep
,PubMed ID 28193781
[Caveolin 1]
|
DNA methylation profiling identifies PTRF/Cavin-1 as a novel tumor suppressor in Ewing sarcoma when co-expressed with caveolin-1
,Huertas-Martínez, J;Court, F;Rello-Varona, S;Herrero-Martín, D;Almacellas-Rabaiget, O;Sáinz-Jaspeado, M;Garcia-Monclús, S;Lagares-Tena, L;Buj, R;Hontecillas-Prieto, L;Sastre, A;Azorin, D;Sanjuan, X;López-Alemany, R;Moran, S;Roma, J;Gallego, S;Mora, J;García Del Muro, X;Giangrande, PH;Peinado, MA;Alonso, J;de Alava, E;Monk, D;Esteller, M;Tirado, OM;,
Cancer Lett.
,PubMed ID 27894957
[Caveolin 1]
|
ROR1 sustains caveolae and survival signalling as a scaffold of cavin-1 and caveolin-1
,Yamaguchi, T;Lu, C;Ida, L;Yanagisawa, K;Usukura, J;Cheng, J;Hotta, N;Shimada, Y;Isomura, H;Suzuki, M;Fujimoto, T;Takahashi, T;,
Nat Commun
,PubMed ID 26725982
[Caveolin 1]
|
Caveolin-1 is a negative regulator of NADPH oxidase-derived reactive oxygen species
,Chen, F;Barman, S;Yu, Y;Haigh, S;Wang, Y;Dou, H;Bagi, Z;Han, W;Su, Y;Fulton, DJ;,
Free Radic. Biol. Med.
,PubMed ID 24835767
[Caveolin 1]
|
Overexpression of caveolin-1 is sufficient to phenocopy the behavior of a disease-associated mutant
,null,
Traffic (Copenhagen, Denmark)
,PubMed ID 23469926
[Caveolin 1]
|
Auto-stimulatory action of secreted caveolin-1 on the proliferation of Ewing's sarcoma cells
,null,
International Journal of Oncology
,PubMed ID 21373757
[Caveolin 1]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC210274L1 | Lenti ORF clone of Human caveolin 1, caveolae protein, 22kDa (CAV1), transcript variant 1, Myc-DDK-tagged |
CNY 4,800.00 |
|
RC210274L2 | Lenti ORF clone of Human caveolin 1, caveolae protein, 22kDa (CAV1), transcript variant 1, mGFP tagged |
CNY 4,800.00 |
|
RC210274L3 | Lenti ORF clone of Human caveolin 1, caveolae protein, 22kDa (CAV1), transcript variant 1, Myc-DDK-tagged |
CNY 4,800.00 |
|
RC210274L4 | Lenti ORF clone of Human caveolin 1, caveolae protein, 22kDa (CAV1), transcript variant 1, mGFP tagged |
CNY 4,800.00 |
|
RG210274 | CAV1 (tGFP-tagged) - Human caveolin 1, caveolae protein, 22kDa (CAV1), transcript variant 1 |
CNY 4,000.00 |
|
SC119082 | CAV1 (untagged)-Human caveolin 1, caveolae protein, 22kDa (CAV1), transcript variant 1 |
CNY 2,400.00 |
其它Caveolin 1产品