AP1S2 (NM_003916) Human Tagged ORF Clone
CAT#: RC210030
AP1S2 (Myc-DDK-tagged)-Human adaptor-related protein complex 1, sigma 2 subunit (AP1S2)
ORF Plasmid: tGFP
"NM_003916" in other vectors (7)
Need custom modification / cloning service?
Get a free quote
CNY 1,800.00
CNY 3,705.00
CNY 300.00
CNY 6,281.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | DC22; MRX59; MRXS5; MRXS21; MRXSF; PGS; SIGMA1B |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC210030 representing NM_003916
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGCAGTTTATGTTGCTTTTTAGTCGTCAGGGAAAGCTTCGACTGCAAAAATGGTATGTCCCACTATCAG ACAAAGAGAAGAAAAAGATCACAAGAGAACTTGTTCAGACCGTTTTAGCACGGAAACCTAAAATGTGCAG CTTCCTTGAGTGGCGAGATCTGAAGATTGTTTACAAAAGATATGCTAGTCTGTATTTTTGCTGTGCTATT GAGGATCAGGACAATGAACTAATTACCCTGGAAATAATTCATCGTTATGTGGAATTACTTGACAAGTATT TCGGCAGTGTCTGTGAACTAGATATCATCTTTAATTTTGAGAAGGCTTATTTTATTTTGGATGAGTTTCT TTTGGGAGGGGAAGTTCAGGAAACATCCAAGAAAAATGTCCTTAAAGCAATTGAGCAGGCTGATCTACTG CAGGAGGAAGCTGAAACCCCACGTAGTGTTCTTGAAGAAATTGGACTGACA ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC210030 representing NM_003916
Red=Cloning site Green=Tags(s) MQFMLLFSRQGKLRLQKWYVPLSDKEKKKITRELVQTVLARKPKMCSFLEWRDLKIVYKRYASLYFCCAI EDQDNELITLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLLGGEVQETSKKNVLKAIEQADLL QEEAETPRSVLEEIGLT myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_003916 |
ORF Size | 471 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_003916.5 |
RefSeq Size | 2283 bp |
RefSeq ORF | 474 bp |
Locus ID | 8905 |
UniProt ID | P56377 |
Domains | Clat_adaptor_s |
Protein Families | Druggable Genome |
Protein Pathways | Lysosome |
MW | 18.4 kDa |
Gene Summary | Adaptor protein complex 1 is found at the cytoplasmic face of coated vesicles located at the Golgi complex, where it mediates both the recruitment of clathrin to the membrane and the recognition of sorting signals within the cytosolic tails of transmembrane receptors. This complex is a heterotetramer composed of two large, one medium, and one small adaptin subunit. The protein encoded by this gene serves as the small subunit of this complex and is a member of the adaptin protein family. Transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2013] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC210030L1 | Lenti ORF clone of Human adaptor-related protein complex 1, sigma 2 subunit (AP1S2), Myc-DDK-tagged |
CNY 4,200.00 |
|
RC210030L2 | Lenti ORF clone of Human adaptor-related protein complex 1, sigma 2 subunit (AP1S2), mGFP tagged |
CNY 5,890.00 |
|
RC210030L3 | Lenti ORF clone of Human adaptor-related protein complex 1, sigma 2 subunit (AP1S2), Myc-DDK-tagged |
CNY 5,890.00 |
|
RC210030L4 | Lenti ORF clone of Human adaptor-related protein complex 1, sigma 2 subunit (AP1S2), mGFP tagged |
CNY 5,890.00 |
|
RG210030 | AP1S2 (tGFP-tagged) - Human adaptor-related protein complex 1, sigma 2 subunit (AP1S2) |
CNY 3,400.00 |
|
SC310658 | AP1S2 (untagged)-Human adaptor-related protein complex 1, sigma 2 subunit (AP1S2) |
CNY 3,990.00 |
|
SC321009 | AP1S2 (untagged)-Human adaptor-related protein complex 1, sigma 2 subunit (AP1S2) |
CNY 1,200.00 |