Ferritin Heavy Chain (FTH1) (NM_002032) Human Tagged ORF Clone
CAT#: RC209845
FTH1 (Myc-DDK-tagged)-Human ferritin, heavy polypeptide 1 (FTH1)
ORF Plasmid: tGFP
"NM_002032" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 2,400.00
CNY 3,705.00
Cited in 7 publications. |
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | FHC; FTH; FTHL6; HFE5; PIG15; PLIF |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC209845 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGACGACCGCGTCCACCTCGCAGGTGCGCCAGAACTACCACCAGGACTCAGAGGCCGCCATCAACCGCC AGATCAACCTGGAGCTCTACGCCTCCTACGTTTACCTGTCCATGTCTTACTACTTTGACCGCGATGATGT GGCTTTGAAGAACTTTGCCAAATACTTTCTTCACCAATCTCATGAGGAGAGGGAACATGCTGAGAAACTG ATGAAGCTGCAGAACCAACGAGGTGGCCGAATCTTCCTTCAGGATATCAAGAAACCAGACTGTGATGACT GGGAGAGCGGGCTGAATGCAATGGAGTGTGCATTACATTTGGAAAAAAATGTGAATCAGTCACTACTGGA ACTGCACAAACTGGCCACTGACAAAAATGACCCCCATTTGTGTGACTTCATTGAGACACATTACCTGAAT GAGCAGGTGAAAGCCATCAAAGAATTGGGTGACCACGTGACCAACTTGCGCAAGATGGGAGCGCCCGAAT CTGGCTTGGCGGAATATCTCTTTGACAAGCACACCCTGGGAGACAGTGATAATGAAAGC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC209845 protein sequence
Red=Cloning site Green=Tags(s) MTTASTSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKL MKLQNQRGGRIFLQDIKKPDCDDWESGLNAMECALHLEKNVNQSLLELHKLATDKNDPHLCDFIETHYLN EQVKAIKELGDHVTNLRKMGAPESGLAEYLFDKHTLGDSDNES myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_002032 |
ORF Size | 549 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_002032.3 |
RefSeq Size | 1245 bp |
RefSeq ORF | 552 bp |
Locus ID | 2495 |
UniProt ID | P02794 |
Domains | ferritin |
Protein Families | Druggable Genome |
Protein Pathways | Porphyrin and chlorophyll metabolism |
MW | 21.2 kDa |
Gene Summary | This gene encodes the heavy subunit of ferritin, the major intracellular iron storage protein in prokaryotes and eukaryotes. It is composed of 24 subunits of the heavy and light ferritin chains. Variation in ferritin subunit composition may affect the rates of iron uptake and release in different tissues. A major function of ferritin is the storage of iron in a soluble and nontoxic state. Defects in ferritin proteins are associated with several neurodegenerative diseases. This gene has multiple pseudogenes. Several alternatively spliced transcript variants have been observed, but their biological validity has not been determined. [provided by RefSeq, Jul 2008] |
Citations (7)
The use of this cDNA Clones has been cited in the following citations: |
---|
Intracellular ferritin heavy chain plays the key role in artesunate-induced ferroptosis in ovarian serous carcinoma cells
,null,
Journal of Clinical Biochemistry and Nutrition
,PubMed ID 35903602
[Ferritin Heavy Chain]
|
Baicalin induces ferroptosis in bladder cancer cells by downregulating FTH1
,Kong, N;Chen, X;Feng, J;Duan, T;Liu, S;Sun, X;Chen, P;Pan, T;Yan, L;Jin, T;Xiang, Y;Gao, Q;Wen, C;Ma, W;Liu, W;Zhang, M;Yang, Z;Wang, W;Zhang, R;Chen, B;Xie, T;Sui, X;Tao, W;,
Acta Pharmaceutica Sinica B
[Ferritin Heavy Chain]
|
Baicalin induces ferroptosis in bladder cancer cells by downregulating FTH1
,null,
Acta Pharmaceutica Sinica. B
,PubMed ID 35024325
[Ferritin Heavy Chain]
|
Oligodendrocytes Provide Antioxidant Defense Function for Neurons by Secreting Ferritin Heavy Chain
,Mukherjee, C;Kling, T;Russo, B;Miebach, K;Kess, E;Schifferer, M;Pedro, LD;Weikert, U;Fard, MK;Kannaiyan, N;Rossner, M;Aicher, ML;Goebbels, S;Nave, KA;Krämer-Albers, EM;Schneider, A;Simons, M;,
Cell Metab.
,PubMed ID 32531201
[Ferritin Heavy Chain]
|
Magnetic resonance imaging of infarct-induced canonical Wnt/ß-catenin/TCF pathway activation, in vivo
,Matteucci, M;Casieri, V;Gabisonia, K;Aquaro, GD;Agostini, S;Pollio, G;Diamanti, D;Rossi, M;Travagli, M;Porcari, V;Recchia, FA;Lionetti, V;,
Cardiovasc. Res.
,PubMed ID 27671803
[Ferritin Heavy Chain]
|
Multimodal molecular imaging system for pathway-specific reporter gene expression
,Rossi, M;Massai, L;Diamanti, D;Fiengo, P;De Rosa, A;Magrini, R;Magnoni, L;Chellini, S;Coniglio, S;Diodato, E;Pilli, E;Caradonna, NP;Sardone, G;Monti, M;Roggeri, R;Lionetti, V;Recchia, F;Tunici, P;Valensin, S;Scali, C;Pollio, G;Porcari, V;,
Eur J Pharm Sci
,PubMed ID 26987608
[Ferritin Heavy Chain]
|
A novel nanoprobe for the sensitive detection of Francisella tularensis
,Kim, JE;Seo, Y;Jeong, Y;Hwang, MP;Hwang, J;Choo, J;Hong, JW;Jeon, JH;Rhie, GE;Choi, J;,
J. Hazard. Mater.
,PubMed ID 26057442
[Ferritin Heavy Chain]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC209845L1 | Lenti ORF clone of Human ferritin, heavy polypeptide 1 (FTH1), Myc-DDK-tagged |
CNY 4,800.00 |
|
RC209845L2 | Lenti ORF clone of Human ferritin, heavy polypeptide 1 (FTH1), mGFP tagged |
CNY 4,800.00 |
|
RC209845L3 | Lenti ORF clone of Human ferritin, heavy polypeptide 1 (FTH1), Myc-DDK-tagged |
CNY 4,800.00 |
|
RC209845L4 | Lenti ORF clone of Human ferritin, heavy polypeptide 1 (FTH1), mGFP tagged |
CNY 4,800.00 |
|
RG209845 | FTH1 (tGFP-tagged) - Human ferritin, heavy polypeptide 1 (FTH1) |
CNY 4,000.00 |
|
SC118860 | FTH1 (untagged)-Human ferritin, heavy polypeptide 1 (FTH1) |
CNY 2,400.00 |
其它Ferritin Heavy Chain产品