United States
Germany
Japan
United Kingdom
China
H4-16 (NM_175054) Human Tagged ORF Clone
CAT＃: RC205064
HIST4H4 (Myc-DDK-tagged)-Human histone cluster 4, H4 (HIST4H4)
ORF Plasmid: tGFP
"NM_175054" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 1,200.00
CNY 3,705.00
| Cited in 1 publication. |
Product images
CNY 300.00
Specifications
| Product Data | |
| Type | Human Tagged ORF Clone |
| Tag | Myc-DDK |
| Synonyms | H4/p; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9; H4C11; H4C12; H4C13; H4C14; H4C15; HIST4H4 |
| Vector | pCMV6-Entry |
| E. coli Selection | Kanamycin (25 ug/mL) |
| Mammalian Cell Selection | Neomycin |
| Sequence Data |
>RC205064 representing NM_175054
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGTCTGGGCGAGGTAAAGGTGGCAAGGGGCTGGGTAAGGGAGGCGCCAAGCGCCACCGGAAGGTGCTGC GGGACAATATCCAAGGCATTACAAAGCCGGCGATTCGCCGTCTCGCCCGACGTGGGGGCGTCAAGCGCAT TTCTGGTCTCATCTACGAGGAGACCCGGGGAGTCCTCAAAGTCTTCCTGGAGAACGTGATCCGTGACGCG GTGACTTACACGGAGCACGCCAAGCGCAAGACCGTCACGGCCATGGATGTGGTGTACGCGCTGAAACGCC AGGGTCGCACCCTTTATGGTTTCGGCGGT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC205064 representing NM_175054
Red=Cloning site Green=Tags(s) MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDA VTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG myc-FLAG tag |
| Chromatograms |
CHROMATOGRAMS
 Sequencher program is needed, download here. |
| Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
|
| ACCN | NM_175054 |
| ORF Size | 309 bp |
| OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
| OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
| Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
| Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
| Reference Data | |
| RefSeq | NM_175054.2, NP_778224.1 |
| RefSeq Size | 412 bp |
| RefSeq ORF | 312 bp |
| Locus ID | 121504 |
| UniProt ID | P62805 |
| Protein Pathways | Systemic lupus erythematosus |
| MW | 11.2 kDa |
| Gene Summary | Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H4 family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. [provided by RefSeq, Aug 2015] |
Citations (1)
| The use of this cDNA Clones has been cited in the following citations: |
|---|
|
Profiling DNA damage response following mitotic perturbations
,S Pedersen, R;Karemore, G;Gudjonsson, T;Rask, MB;Neumann, B;Hériché, JK;Pepperkok, R;Ellenberg, J;Gerlich, DW;Lukas, J;Lukas, C;,
Nat Commun
,PubMed ID 27976684
[H4-16]
|
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| RC205064L1 | Lenti ORF clone of Human histone cluster 4, H4 (HIST4H4), Myc-DDK-tagged |
CNY 3,600.00 |
|
| RC205064L2 | Lenti ORF clone of Human histone cluster 4, H4 (HIST4H4), mGFP tagged |
CNY 5,890.00 |
|
| RC205064L3 | Lenti ORF clone of Human histone cluster 4, H4 (HIST4H4), Myc-DDK-tagged |
CNY 5,890.00 |
|
| RC205064L4 | Lenti ORF clone of Human histone cluster 4, H4 (HIST4H4), mGFP tagged |
CNY 3,600.00 |
|
| RG205064 | HIST4H4 (tGFP-tagged) - Human histone cluster 4, H4 (HIST4H4) |
CNY 2,800.00 |
|
| SC319933 | HIST4H4 (untagged)-Human histone cluster 4, H4 (HIST4H4) |
CNY 1,200.00 |
