Macrophage Inflammatory Protein 3 alpha (CCL20) (NM_004591) Human Tagged ORF Clone
CAT#: RC204691
CCL20 (Myc-DDK-tagged)-Human chemokine (C-C motif) ligand 20 (CCL20), transcript variant 1
ORF Plasmid: tGFP
"NM_004591" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 1,200.00
CNY 3,705.00
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | CKb4; Exodus; LARC; MIP-3-alpha; MIP-3a; MIP3A; SCYA20; ST38 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC204691 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGTGCTGTACCAAGAGTTTGCTCCTGGCTGCTTTGATGTCAGTGCTGCTACTCCACCTCTGCGGCGAAT CAGAAGCAAGCAACTTTGACTGCTGTCTTGGATACACAGACCGTATTCTTCATCCTAAATTTATTGTGGG CTTCACACGGCAGCTGGCCAATGAAGGCTGTGACATCAATGCTATCATCTTTCACACAAAGAAAAAGTTG TCTGTGTGCGCAAATCCAAAACAGACTTGGGTGAAATATATTGTGCGTCTCCTCAGTAAAAAAGTCAAGA ACATG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC204691 protein sequence
Red=Cloning site Green=Tags(s) MCCTKSLLLAALMSVLLLHLCGESEASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKL SVCANPKQTWVKYIVRLLSKKVKNM myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_004591 |
ORF Size | 285 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_004591.3 |
RefSeq Size | 851 bp |
RefSeq ORF | 291 bp |
Locus ID | 6364 |
UniProt ID | P78556 |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Chemokine signaling pathway, Cytokine-cytokine receptor interaction |
MW | 10.7 kDa |
Gene Summary | This antimicrobial gene belongs to the subfamily of small cytokine CC genes. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The protein encoded by this gene displays chemotactic activity for lymphocytes and can repress proliferation of myeloid progenitors. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2014] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC204691L1 | Lenti ORF clone of Human chemokine (C-C motif) ligand 20 (CCL20), transcript variant 1, Myc-DDK-tagged |
CNY 3,600.00 |
|
RC204691L2 | Lenti ORF clone of Human chemokine (C-C motif) ligand 20 (CCL20), transcript variant 1, mGFP tagged |
CNY 5,890.00 |
|
RC204691L3 | Lenti ORF clone of Human chemokine (C-C motif) ligand 20 (CCL20), transcript variant 1, Myc-DDK-tagged |
CNY 5,890.00 |
|
RC204691L4 | Lenti ORF clone of Human chemokine (C-C motif) ligand 20 (CCL20), transcript variant 1, mGFP tagged |
CNY 3,600.00 |
|
RG204691 | CCL20 (tGFP-tagged) - Human chemokine (C-C motif) ligand 20 (CCL20), transcript variant 1 |
CNY 4,370.00 |
|
SC122685 | CCL20 (untagged)-Human chemokine (C-C motif) ligand 20 (CCL20), transcript variant 1 |
CNY 1,200.00 |
其它Macrophage Inflammatory Protein 3 alpha产品