Cofilin 1 (CFL1) (NM_005507) Human Tagged ORF Clone

CAT#: RC203585

CFL1 (Myc-DDK-tagged)-Human cofilin 1 (non-muscle) (CFL1)

ORF Plasmid: DDK tGFP



  "NM_005507" in other vectors (6)

Need custom modification / cloning service?
Get a free quote

CNY 1,200.00

CNY 3,705.00


货期*
现货

规格
    • 10 ug

Cited in 3 publications.

Product images

经常一起买 (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00


Rabbit polyclonal anti-Cofilin antibody, Loading control
    • 100 ul

CNY 3,800.00

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Synonyms CFL; cofilin; HEL-S-15
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC203585 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCTCCGGTGTGGCTGTCTCTGATGGTGTCATCAAGGTGTTCAACGACATGAAGGTGCGTAAGTCTT
CAACGCCAGAGGAGGTGAAGAAGCGCAAGAAGGCGGTGCTCTTCTGCCTGAGTGAGGACAAGAAGAACAT
CATCCTGGAGGAGGGCAAGGAGATCCTGGTGGGCGATGTGGGCCAGACTGTCGACGATCCCTACGCCACC
TTTGTCAAGATGCTGCCAGATAAGGACTGCCGCTATGCCCTCTATGATGCAACCTATGAGACCAAGGAGA
GCAAGAAGGAGGATCTGGTGTTTATCTTCTGGGCCCCCGAGTCTGCGCCCCTTAAGAGCAAAATGATTTA
TGCCAGCTCCAAGGACGCCATCAAGAAGAAGCTGACAGGGATCAAGCATGAATTGCAAGCAAACTGCTAC
GAGGAGGTCAAGGACCGCTGCACCCTGGCAGAGAAGCTGGGGGGCAGTGCCGTCATCTCCCTGGAGGGCA
AGCCTTTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC203585 protein sequence
Red=Cloning site Green=Tags(s)

MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYAT
FVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCY
EEVKDRCTLAEKLGGSAVISLEGKPL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_005507
ORF Size 498 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_005507.3
RefSeq Size 1260 bp
RefSeq ORF 501 bp
Locus ID 1072
UniProt ID P23528
Domains ADF
Protein Families Druggable Genome
Protein Pathways Axon guidance, Fc gamma R-mediated phagocytosis, Regulation of actin cytoskeleton
MW 18.5 kDa
Gene Summary The protein encoded by this gene can polymerize and depolymerize F-actin and G-actin in a pH-dependent manner. Increased phosphorylation of this protein by LIM kinase aids in Rho-induced reorganization of the actin cytoskeleton. Cofilin is a widely distributed intracellular actin-modulating protein that binds and depolymerizes filamentous F-actin and inhibits the polymerization of monomeric G-actin in a pH-dependent manner. It is involved in the translocation of actin-cofilin complex from cytoplasm to nucleus.[supplied by OMIM, Apr 2004]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (3)

Other Versions

Customer Reviews 
Loading...