United States
Germany
Japan
United Kingdom
China
COX7A2L (NM_004718) Human Tagged ORF Clone
CAT＃: RC202697
COX7A2L (Myc-DDK-tagged)-Human cytochrome c oxidase subunit VIIa polypeptide 2 like (COX7A2L), nuclear gene encoding mitochondrial protein
ORF Plasmid: tGFP
"NM_004718" in other vectors (4)
Need custom modification / cloning service?
Get a free quote
CNY 1,200.00
CNY 3,705.00
| Cited in 4 publications. |
Product images
CNY 300.00
Specifications
| Product Data | |
| Type | Human Tagged ORF Clone |
| Tag | Myc-DDK |
| Synonyms | COX7AR; COX7RP; EB1; SCAF1; SCAFI; SIG81 |
| Vector | pCMV6-Entry |
| E. coli Selection | Kanamycin (25 ug/mL) |
| Mammalian Cell Selection | Neomycin |
| Sequence Data |
>RC202697 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGTACTACAAGTTTAGTGGCTTCACGCAGAAGTTGGCAGGAGCATGGGCTTCGGAGGCCTATAGCCCGC AGGGATTAAAGCCTGTGGTTTCCACAGAAGCACCACCTATCATATTTGCCACACCAACTAAACTGACCTC CGATTCCACAGTGTATGATTATGCTGGGAAAAACAAAGTTCCAGAGCTACAAAAGTTTTTCCAGAAAGCT GATGGTGTGCCCGTCTACCTGAAACGAGGCCTGCCTGACCAAATGCTTTACCGGACCACCATGGCGCTGA CTGTGGGAGGGACCATCTACTGCCTGATCGCCCTCTACATGGCTTCGCAGCCCAAAAACAAA ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC202697 protein sequence
Red=Cloning site Green=Tags(s) MYYKFSGFTQKLAGAWASEAYSPQGLKPVVSTEAPPIIFATPTKLTSDSTVYDYAGKNKVPELQKFFQKA DGVPVYLKRGLPDQMLYRTTMALTVGGTIYCLIALYMASQPKNK myc-FLAG tag |
| Chromatograms |
CHROMATOGRAMS
 Sequencher program is needed, download here. |
| Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
|
| ACCN | NM_004718 |
| ORF Size | 342 bp |
| OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
| OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
| Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
| Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
| Reference Data | |
| RefSeq | NM_004718.4 |
| RefSeq Size | 1145 bp |
| RefSeq ORF | 345 bp |
| Locus ID | 9167 |
| UniProt ID | O14548 |
| Domains | COX7a |
| Protein Families | Druggable Genome, Transmembrane |
| Protein Pathways | Alzheimer's disease, Cardiac muscle contraction, Huntington's disease, Oxidative phosphorylation, Parkinson's disease |
| MW | 12.6 kDa |
| Gene Summary | Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes a protein similar to polypeptides 1 and 2 of subunit VIIa in the C-terminal region, and also highly similar to the mouse Sig81 protein sequence. This gene is expressed in all tissues, and upregulated in a breast cancer cell line after estrogen treatment. It is possible that this gene represents a regulatory subunit of COX and mediates the higher level of energy production in target cells by estrogen. Several transcript variants, some protein-coding and others non-protein coding, have been found for this gene. [provided by RefSeq, Jan 2016] |
Citations (4)
| The use of this cDNA Clones has been cited in the following citations: |
|---|
|
Two independent respiratory chains adapt OXPHOS performance to glycolytic switch.
,null,
Cell metabolism
,PubMed ID 36198313
[COX7A2L]
|
|
Distinct Roles of Mitochondrial HIGD1A and HIGD2A in Respiratory Complex and Supercomplex Biogenesis
,Timón-Gómez, A;Garlich, J;Stuart, RA;Ugalde, C;Barrientos, A;,
Cell Rep
,PubMed ID 32375044
[COX7A2L]
|
|
Human COX7A2L Regulates Complex III Biogenesis and Promotes Supercomplex Organization Remodeling without Affecting Mitochondrial Bioenergetics
,null,
Cell reports
,PubMed ID 30428348
[COX7A2L]
|
|
COX7A2L Is a Mitochondrial Complex III Binding Protein that Stabilizes the III 2+ IV Supercomplex without Affecting Respirasome Formation
,Pérez-Pérez, R;Lobo-Jarne, T;Milenkovic, D;Mourier, A;Bratic, A;García-Bartolomé, A;Fernández-Vizarra, E;Cadenas, S;Delmiro, A;García-Consuegra, I;Arenas, J;Martín, MA;Larsson, N;Ugalde, C;,
Cell Reports
,PubMed ID 27545886
[COX7A2L]
|
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| RC202697L3 | Lenti ORF clone of Human cytochrome c oxidase subunit VIIa polypeptide 2 like (COX7A2L), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged |
CNY 5,890.00 |
|
| RC202697L4 | Lenti ORF clone of Human cytochrome c oxidase subunit VIIa polypeptide 2 like (COX7A2L), nuclear gene encoding mitochondrial protein, mGFP tagged |
CNY 5,890.00 |
|
| RG202697 | COX7A2L (tGFP-tagged) - Human cytochrome c oxidase subunit VIIa polypeptide 2 like (COX7A2L), nuclear gene encoding mitochondrial protein |
CNY 2,800.00 |
|
| SC117225 | COX7A2L (untagged)-Human cytochrome c oxidase subunit VIIa polypeptide 2 like (COX7A2L), nuclear gene encoding mitochondrial protein |
CNY 1,200.00 |
其它COX7A2L产品
