CBFB (NM_001755) Human Tagged ORF Clone

CAT#: RC202111

CBFB (Myc-DDK-tagged)-Human core-binding factor, beta subunit (CBFB), transcript variant 2

ORF Plasmid: DDK tGFP



  "NM_001755" in other vectors (6)

Need custom modification / cloning service?
Get a free quote

CNY 2,400.00

CNY 3,705.00


货期*
现货

规格
    • 10 ug

Product images

经常一起买 (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00


Rabbit polyclonal CBFB Antibody (Center)
    • 400 ul

CNY 6,314.00

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Synonyms PEBP2B
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC202111 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCGCGCGTCGTGCCCGACCAGAGAAGCAAGTTCGAGAACGAGGAGTTTTTTAGGAAGCTGAGCCGCG
AGTGTGAGATTAAGTACACGGGCTTCAGGGACCGGCCCCACGAGGAACGCCAGGCACGCTTCCAGAACGC
CTGCCGCGACGGCCGCTCGGAAATCGCTTTTGTGGCCACAGGAACCAATCTGTCTCTCCAGTTTTTTCCG
GCCAGCTGGCAGGGAGAACAGCGACAAACACCTAGCCGAGAGTATGTCGACTTAGAAAGAGAAGCAGGCA
AGGTATATTTGAAGGCTCCCATGATTCTGAATGGAGTCTGTGTTATCTGGAAAGGCTGGATTGATCTCCA
AAGACTGGATGGTATGGGCTGTCTGGAGTTTGATGAGGAGCGAGCCCAGCAGGAGGATGCATTAGCACAA
CAGGCCTTTGAAGAGGCTCGGAGAAGGACACGCGAATTTGAAGATAGAGACAGGTCTCATCGGGAGGAAA
TGGAGGTGAGAGTTTCACAGCTGCTGGCAGTAACTGGCAAGAAGACAACAAGACCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC202111 protein sequence
Red=Cloning site Green=Tags(s)

MPRVVPDQRSKFENEEFFRKLSRECEIKYTGFRDRPHEERQARFQNACRDGRSEIAFVATGTNLSLQFFP
ASWQGEQRQTPSREYVDLEREAGKVYLKAPMILNGVCVIWKGWIDLQRLDGMGCLEFDEERAQQEDALAQ
QAFEEARRRTREFEDRDRSHREEMEVRVSQLLAVTGKKTTRP

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001755
ORF Size 546 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001755.3
RefSeq Size 3181 bp
RefSeq ORF 549 bp
Locus ID 865
UniProt ID Q13951
Domains CBF_beta
Protein Families Druggable Genome, Transcription Factors
MW 21.5 kDa
Gene Summary The protein encoded by this gene is the beta subunit of a heterodimeric core-binding transcription factor belonging to the PEBP2/CBF transcription factor family which master-regulates a host of genes specific to hematopoiesis (e.g., RUNX1) and osteogenesis (e.g., RUNX2). The beta subunit is a non-DNA binding regulatory subunit; it allosterically enhances DNA binding by alpha subunit as the complex binds to the core site of various enhancers and promoters, including murine leukemia virus, polyomavirus enhancer, T-cell receptor enhancers and GM-CSF promoters. Alternative splicing generates two mRNA variants, each encoding a distinct carboxyl terminus. In some cases, a pericentric inversion of chromosome 16 [inv(16)(p13q22)] produces a chimeric transcript consisting of the N terminus of core-binding factor beta in a fusion with the C-terminal portion of the smooth muscle myosin heavy chain 11. This chromosomal rearrangement is associated with acute myeloid leukemia of the M4Eo subtype. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...