Noxa (PMAIP1) (NM_021127) Human Tagged ORF Clone
CAT#: RC202071
PMAIP1 (Myc-DDK-tagged)-Human phorbol-12-myristate-13-acetate-induced protein 1 (PMAIP1)
ORF Plasmid: tGFP
"NM_021127" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 1,200.00
CNY 3,705.00
Cited in 1 publication. |
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | APR; NOXA |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC202071 representing NM_021127
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGCCTGGGAAGAAGGCGCGCAAGAACGCTCAACCGAGCCCCGCGCGGGCTCCAGCAGAGCTGGAAGTCG AGTGTGCTACTCAACTCAGGAGATTTGGAGACAAACTGAACTTCCGGCAGAAACTTCTGAATCTGATATC CAAACTCTTCTGCTCAGGAACC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC202071 representing NM_021127
Red=Cloning site Green=Tags(s) MPGKKARKNAQPSPARAPAELEVECATQLRRFGDKLNFRQKLLNLISKLFCSGT myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_021127 |
ORF Size | 162 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_021127.3 |
RefSeq Size | 1885 bp |
RefSeq ORF | 165 bp |
Locus ID | 5366 |
UniProt ID | Q13794 |
Protein Families | Druggable Genome, Stem cell - Pluripotency |
Protein Pathways | p53 signaling pathway |
MW | 5.8 kDa |
Gene Summary | This gene belongs to a pro-apoptotic subfamily within the BCL-2 protein family, referred to as the BCL-2 homology domain 3 (BH3)-only subfamily, which determine whether a cell commits to apoptosis. In response to death-inducing stimuli, BH3-only members inhibit the anti-apoptotic BCL-2 family members, which under steady-state conditions keep the multi-BH domain proteins BAX and BAK, in an inactive state. [provided by RefSeq, Aug 2020] |
Citations (1)
The use of this cDNA Clones has been cited in the following citations: |
---|
α7 nicotinic acetylcholine receptor upregulation by anti-apoptotic Bcl-2 proteins
,Dawe, GB;Yu, H;Gu, S;Blackler, AN;Matta, JA;Siuda, ER;Rex, EB;Bredt, DS;,
Nat Commun
,PubMed ID 31227712
[Noxa]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC202071L1 | Lenti ORF clone of Human phorbol-12-myristate-13-acetate-induced protein 1 (PMAIP1), Myc-DDK-tagged |
CNY 3,600.00 |
|
RC202071L2 | Lenti ORF clone of Human phorbol-12-myristate-13-acetate-induced protein 1 (PMAIP1), mGFP tagged |
CNY 5,890.00 |
|
RC202071L3 | Lenti ORF clone of Human phorbol-12-myristate-13-acetate-induced protein 1 (PMAIP1), Myc-DDK-tagged |
CNY 3,600.00 |
|
RC202071L4 | Lenti ORF clone of Human phorbol-12-myristate-13-acetate-induced protein 1 (PMAIP1), mGFP tagged |
CNY 3,600.00 |
|
RG202071 | PMAIP1 (tGFP-tagged) - Human phorbol-12-myristate-13-acetate-induced protein 1 (PMAIP1) |
CNY 2,800.00 |
|
SC112973 | PMAIP1 (untagged)-Human phorbol-12-myristate-13-acetate-induced protein 1 (PMAIP1) |
CNY 1,200.00 |