United States
Germany
Japan
United Kingdom
China
IFITM1 (NM_003641) Human Tagged ORF Clone
CAT＃: RC201617
IFITM1 (Myc-DDK-tagged)-Human interferon induced transmembrane protein 1 (9-27) (IFITM1)
ORF Plasmid: tGFP
"NM_003641" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 1,200.00
CNY 3,705.00
| Cited in 3 publications. |
Product images
CNY 300.00
Specifications
| Product Data | |
| Type | Human Tagged ORF Clone |
| Tag | Myc-DDK |
| Synonyms | 9-27; CD225; DSPA2a; IFI17; LEU13 |
| Vector | pCMV6-Entry |
| E. coli Selection | Kanamycin (25 ug/mL) |
| Mammalian Cell Selection | Neomycin |
| Sequence Data |
>RC201617 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGCACAAGGAGGAACATGAGGTGGCTGTGCTGGGGGCACCCCCCAGCACCATCCTTCCAAGGTCCACCG TGATCAACATCCACAGCGAGACCTCCGTGCCCGACCATGTCGTCTGGTCCCTGTTCAACACCCTCTTCTT GAACTGGTGCTGTCTGGGCTTCATAGCATTCGCCTACTCCGTGAAGTCTAGGGACAGGAAGATGGTTGGC GACGTGACCGGGGCCCAGGCCTATGCCTCCACCGCCAAGTGCCTGAACATCTGGGCCCTGATTCTGGGCA TCCTCATGACCATTGGATTCATCCTGTTACTGGTATTCGGCTCTGTGACAGTCTACCATATTATGTTACA GATAATACAGGAAAAACGGGGTTAC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC201617 protein sequence
Red=Cloning site Green=Tags(s) MHKEEHEVAVLGAPPSTILPRSTVINIHSETSVPDHVVWSLFNTLFLNWCCLGFIAFAYSVKSRDRKMVG DVTGAQAYASTAKCLNIWALILGILMTIGFILLLVFGSVTVYHIMLQIIQEKRGY myc-FLAG tag |
| Chromatograms |
CHROMATOGRAMS
 Sequencher program is needed, download here. |
| Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
|
| ACCN | NM_003641 |
| ORF Size | 375 bp |
| OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
| OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
| Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
| Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
| Reference Data | |
| RefSeq | NM_003641.4 |
| RefSeq Size | 733 bp |
| RefSeq ORF | 378 bp |
| Locus ID | 8519 |
| UniProt ID | P13164 |
| Domains | CD225 |
| Protein Families | Druggable Genome, Transmembrane |
| Protein Pathways | B cell receptor signaling pathway |
| MW | 13.9 kDa |
| Gene Summary | IFN-induced antiviral protein which inhibits the entry of viruses to the host cell cytoplasm, permitting endocytosis, but preventing subsequent viral fusion and release of viral contents into the cytosol. Active against multiple viruses, including influenza A virus, SARS coronavirus (SARS-CoV), Marburg virus (MARV), Ebola virus (EBOV), Dengue virus (DNV), West Nile virus (WNV), human immunodeficiency virus type 1 (HIV-1) and hepatitis C virus (HCV). Can inhibit: influenza virus hemagglutinin protein-mediated viral entry, MARV and EBOV GP1,2-mediated viral entry and SARS-CoV S protein-mediated viral entry. Also implicated in cell adhesion and control of cell growth and migration. Plays a key role in the antiproliferative action of IFN-gamma either by inhibiting the ERK activation or by arresting cell growth in G1 phase in a p53-dependent manner. Acts as a positive regulator of osteoblast differentiation.[UniProtKB/Swiss-Prot Function] |
Citations (3)
| The use of this cDNA Clones has been cited in the following citations: |
|---|
|
IFITM1 enhances nonenveloped viral RNA replication by facilitating cholesterol transport to the Golgi
,null,
PLOS Pathogens
,PubMed ID 37252940
[IFITM1]
|
|
Exosomes mediate the cell-to-cell transmission of IFN-a-induced antiviral activity
,Jianhua Li, Kuancheng Liu, Yang Liu, Yan Xu, Fei Zhang, + et al.,
Nature Immunology 14, 793-803 doi:10.1038/ni.2647
,PubMed ID 23832071
[IFITM1]
|
|
ISG56 and IFITM1 Proteins Inhibit Hepatitis C Virus Replication
,Amit Raychoudhuri, Shubham Shrivastava, Robert Steele, Hangeun Kim, Ranjit Ray, and Ratna B. Ray,
J. Virol., Dec 2011; 85: 12881 - 12889.
[IFITM1]
|
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| RC201617L1 | Lenti ORF clone of Human interferon induced transmembrane protein 1 (9-27) (IFITM1), Myc-DDK-tagged |
CNY 3,600.00 |
|
| RC201617L2 | Lenti ORF clone of Human interferon induced transmembrane protein 1 (9-27) (IFITM1), mGFP tagged |
CNY 5,890.00 |
|
| RC201617L3 | Lenti ORF clone of Human interferon induced transmembrane protein 1 (9-27) (IFITM1), Myc-DDK-tagged |
CNY 3,600.00 |
|
| RC201617L4 | Lenti ORF clone of Human interferon induced transmembrane protein 1 (9-27) (IFITM1), mGFP tagged |
CNY 3,600.00 |
|
| RG201617 | IFITM1 (tGFP-tagged) - Human interferon induced transmembrane protein 1 (9-27) (IFITM1) |
CNY 2,800.00 |
|
| SC117830 | IFITM1 (untagged)-Human interferon induced transmembrane protein 1 (9-27) (IFITM1) |
CNY 1,200.00 |
