PSME3 (NM_005789) Human Tagged ORF Clone
CAT#: RC200308
PSME3 (Myc-DDK-tagged)-Human proteasome (prosome, macropain) activator subunit 3 (PA28 gamma, Ki) (PSME3), transcript variant 1
ORF Plasmid: tGFP
"NM_005789" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 2,400.00
CNY 3,705.00
Cited in 3 publications. |
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | HEL-S-283; Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC200308 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCCTCGTTGCTGAAGGTGGATCAGGAAGTGAAGCTCAAGGTTGATTCTTTCAGGGAGCGGATCACAA GTGAGGCAGAAGACTTGGTGGCAAATTTTTTCCCAAAGAAGTTATTAGAACTTGATAGTTTTCTGAAGGA ACCAATCTTAAACATCCATGACCTAACTCAGATCCACTCTGACATGAATCTCCCAGTCCCTGACCCCATT CTTCTCACCAATAGCCATGATGGACTGGATGGTCCCACTTATAAGAAGCGAAGGTTGGATGAGTGTGAAG AAGCCTTCCAAGGAACCAAGGTGTTTGTGATGCCCAATGGGATGCTGAAAAGCAACCAGCAGCTGGTGGA CATTATTGAGAAAGTGAAACCTGAGATCCGGCTGTTGATTGAGAAATGTAACACGGTCAAAATGTGGGTA CAGCTCCTGATTCCCAGGATAGAAGATGGAAACAACTTTGGGGTGTCCATTCAGGAGGAAACAGTTGCAG AGCTAAGAACTGTTGAGAGTGAAGCTGCATCTTATCTGGACCAGATTTCTAGATATTATATTACAAGAGC CAAATTGGTTTCTAAAATAGCTAAATATCCCCATGTGGAGGACTATCGCCGCACCGTGACAGAGATTGAT GAGAAAGAATATATCAGCCTTCGGCTCATCATATCAGAGCTGAGGAATCAATATGTCACTCTACATGACA TGATCCTGAAAAATATCGAGAAGATCAAACGGCCCCGGAGCAGCAATGCAGAGACTCTGTAC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC200308 protein sequence
Red=Cloning site Green=Tags(s) MASLLKVDQEVKLKVDSFRERITSEAEDLVANFFPKKLLELDSFLKEPILNIHDLTQIHSDMNLPVPDPI LLTNSHDGLDGPTYKKRRLDECEEAFQGTKVFVMPNGMLKSNQQLVDIIEKVKPEIRLLIEKCNTVKMWV QLLIPRIEDGNNFGVSIQEETVAELRTVESEAASYLDQISRYYITRAKLVSKIAKYPHVEDYRRTVTEID EKEYISLRLIISELRNQYVTLHDMILKNIEKIKRPRSSNAETLY myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_005789 |
ORF Size | 762 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_005789.4 |
RefSeq Size | 3455 bp |
RefSeq ORF | 765 bp |
Locus ID | 10197 |
UniProt ID | P61289 |
Domains | PA28_alpha, PA28_beta |
Protein Families | Stem cell - Pluripotency |
Protein Pathways | Antigen processing and presentation, Proteasome |
MW | 29.5 kDa |
Gene Summary | The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. The immunoproteasome contains an alternate regulator, referred to as the 11S regulator or PA28, that replaces the 19S regulator. Three subunits (alpha, beta and gamma) of the 11S regulator have been identified. This gene encodes the gamma subunit of the 11S regulator. Six gamma subunits combine to form a homohexameric ring. Alternate splicing results in multiple transcript variants. [provided by RefSeq, May 2012] |
Citations (3)
The use of this cDNA Clones has been cited in the following citations: |
---|
Hepatitis B virus X protein stimulates cell growth by downregulating p16 levels via PA28γ-mediated proteasomal degradation
,Cha, S;Jang, KL;,
J. Gen. Virol.
,PubMed ID 32568029
[PSME3]
|
HBx natural variants containing Ser-101 instead of Pro-101 evade ubiquitin-dependent proteasomal degradation by activating proteasomal activator 28 gamma expression
,Jeong, H;Cha, S;Jang, KL;,
J. Gen. Virol.
,PubMed ID 31596196
[PSME3]
|
Disrupted in Schizophrenia 1 forms pathological aggresomes that disrupt its function in intracellular transport
,Talia A. Atkin, Nicholas J. Brandon, and Josef T. Kittler,
Hum. Mol. Genet., May 2012; 21: 2017 - 2028.
[PSME3]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC200308L1 | Lenti ORF clone of Human proteasome (prosome, macropain) activator subunit 3 (PA28 gamma; Ki) (PSME3), transcript variant 1, Myc-DDK-tagged |
CNY 4,800.00 |
|
RC200308L2 | Lenti ORF clone of Human proteasome (prosome, macropain) activator subunit 3 (PA28 gamma; Ki) (PSME3), transcript variant 1, mGFP tagged |
CNY 5,890.00 |
|
RC200308L3 | Lenti ORF clone of Human proteasome (prosome, macropain) activator subunit 3 (PA28 gamma; Ki) (PSME3), transcript variant 1, Myc-DDK-tagged |
CNY 4,800.00 |
|
RC200308L4 | Lenti ORF clone of Human proteasome (prosome, macropain) activator subunit 3 (PA28 gamma; Ki) (PSME3), transcript variant 1, mGFP tagged |
CNY 4,800.00 |
|
RG200308 | PSME3 (tGFP-tagged) - Human proteasome (prosome, macropain) activator subunit 3 (PA28 gamma; Ki) (PSME3), transcript variant 1 |
CNY 4,000.00 |
|
SC321554 | PSME3 (untagged)-Human proteasome (prosome, macropain) activator subunit 3 (PA28 gamma, Ki) (PSME3), transcript variant 1 |
CNY 2,400.00 |