Vti1a (NM_001293685) Mouse Tagged ORF Clone

CAT#: MR228604

  • TrueORF®

Vti1a (myc-DDK-tagged) - Mouse vesicle transport through interaction with t-SNAREs 1A (Vti1a), transcript variant 1



  "NM_001293685" in other vectors (1)

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 2,280.00


货期*
现货

规格
    • 10 ug

Product images

经常一起买 (4)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Synonyms 1110014F16Rik; 1110018K19Rik; 4921537J05Rik; MVti1; MVti1a; Vti1; Vti1-rp2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR228604 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCTTCCGACTTCGAAGGGTACGAGCAGGACTTCGCAGTGCTCACTGCTGAGATCACCAGCAAGATTG
CAAGGGTCCCTCGGCTCCCTCCCGATGAGAAGAAGCAAATGGTTGCCAATGTGGAGAAACAGCTTGAAGA
GGCCAGAGAACTGCTTGAACAGATGGATTTGGAAGTTCGAGAAATTCCACCCCAAAGTCGAGGAATGTAT
AGCAACAGGATGAGAAGCTACAAGCAAGAAATGGGGAAACTGGAAACGGATTTTAAAAGGTCACGGATCG
CCTACAGTGACGAAGTACGGAATGAGCTCCTAGGGGATGCTGGGAATTCCTCCGAGAACCAGTTGATAAA
ATTACGTGAAGAGAGGGCACATCTGCTGGATAACACGGAGAGGCTGGAAAGGTCGTCTCGGAGACTAGAG
GCTGGGTACCAGATAGCAGTGGAGACTGAGCAAATCGGCCAAGAGATGTTGGAAAACCTGAGTCATGACA
GAGAAAAGATACAGCGGGCACGTGACCGACTCCGGGACGCAGATGCAAACCTGGGGAAGAGCTCTCGGAT
TCTGACGGGGATGCTGCGAAGAATCATCCAGAACCGTATCCTGCTCGTCATCTTGGGGATCATCGTGGTC
ATCGCCATCCTGACGGCCATCGCGTTTTTCGTCAAAGGACAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR228604 protein sequence
Red=Cloning site Green=Tags(s)

MSSDFEGYEQDFAVLTAEITSKIARVPRLPPDEKKQMVANVEKQLEEARELLEQMDLEVREIPPQSRGMY
SNRMRSYKQEMGKLETDFKRSRIAYSDEVRNELLGDAGNSSENQLIKLREERAHLLDNTERLERSSRRLE
AGYQIAVETEQIGQEMLENLSHDREKIQRARDRLRDADANLGKSSRILTGMLRRIIQNRILLVILGIIVV
IAILTAIAFFVKGH

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001293685
ORF Size 675 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001293685.1, NP_001280614.1
RefSeq Size 4620 bp
RefSeq ORF 675 bp
Locus ID 53611
MW 25.9 kDa
Gene Summary V-SNARE that mediates vesicle transport pathways through interactions with t-SNAREs on the target membrane. These interactions are proposed to mediate aspects of the specificity of vesicle trafficking and to promote fusion of the lipid bilayers. Involved in vesicular transport from the late endosomes to the trans-Golgi network. Along with VAMP7, involved in an non-conventional RAB1-dependent traffic route to the cell surface used by KCNIP1 and KCND2. May be concerned with increased secretion of cytokines associated with cellular senescence.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...