Hnrnpd (NM_007516) Mouse Tagged ORF Clone

CAT#: MR203572

  • TrueORF®

Hnrnpd (Myc-DDK-tagged) - Mouse heterogeneous nuclear ribonucleoprotein D (Hnrnpd), transcript variant 3

ORF Plasmid: DDK tGFP



  "NM_007516" in other vectors (3)

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 2,081.00


货期*
现货

规格
    • 10 ug

Product images

经常一起买 (4)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Synonyms Auf1; Hnrpd
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR203572 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCGGAGGAGCAGTTCGGAGGGGACGGGGCGGCGGCGGCGGCAACGGCGGCGGTAGGCGGCTCGGCGG
GCGAGCAGGAGGGAGCCATGGTGGCGGCGGCGGCGCAGGGGCCGGCGGCGGCGGCGGGAAGCGGGAGCGG
CGGCGGCGGCTCTGCGGCCGGAGGCACCGAAGGAGGCAGCGCCGAGGCAGAGGGAGCCAAGATCGACGCC
AGTAAGAACGAGGAGGATGAAGGCCATTCAAACTCCTCCCCACGACACACTGAAGCAGCGGCGGCACAGC
GGGAAGAATGGAAAATGTTTATAGGAGGCCTTAGCTGGGACACCACAAAGAAAGATCTGAAGGACTACTT
TTCCAAATTTGGTGAAGTTGTAGACTGCACTCTGAAGTTAGATCCTATCACAGGGCGATCAAGGGGTTTT
GGCTTTGTGCTATTTAAAGAGTCGGAGAGTGTAGATAAGGTCATGGATCAGAAAGAACATAAATTGAATG
GGAAAGTCATTGATCCTAAAAGGGCCAAAGCCATGAAAACAAAAGAGCCTGTCAAAAAAATTTTTGTTGG
TGGCCTTTCTCCAGACACACCTGAAGAAAAAATAAGAGAGTACTTTGGTGGTTTTGGTGAGGTTGAATCC
ATAGAGCTCCCTATGGACAACAAGACCAATAAGAGGCGTGGGTTCTGTTTTATTACCTTTAAGGAAGAGG
AGCCAGTGAAGAAGATAATGGAAAAGAAATACCACAATGTTGGTCTTAGTAAATGTGAAATAAAAGTAGC
CATGTCAAAGGAACAGTATCAGCAGCAGCAGCAGTGGGGATCTAGAGGAGGGTTTGCAGGCAGAGCTCGC
GGAAGAGGTGGAGATCAGCAGAGTGGTTATGGGAAAGTATCCAGGCGAGGTGGACATCAAAATAGCTACA
AACCATAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR203572 protein sequence
Red=Cloning site Green=Tags(s)

MSEEQFGGDGAAAAATAAVGGSAGEQEGAMVAAAAQGPAAAAGSGSGGGGSAAGGTEGGSAEAEGAKIDA
SKNEEDEGHSNSSPRHTEAAAAQREEWKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGF
GFVLFKESESVDKVMDQKEHKLNGKVIDPKRAKAMKTKEPVKKIFVGGLSPDTPEEKIREYFGGFGEVES
IELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVAMSKEQYQQQQQWGSRGGFAGRAR
GRGGDQQSGYGKVSRRGGHQNSYKPY

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_007516
ORF Size 921 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_007516.3
RefSeq Size 6664 bp
RefSeq ORF 921 bp
Locus ID 11991
UniProt ID Q60668
MW 32.8 kDa
Gene Summary Binds with high affinity to RNA molecules that contain AU-rich elements (AREs) found within the 3' UTR of many proto-oncogenes and cytokine mRNAs. Also binds to double- and single-stranded DNA sequences in a specific manner and functions a transcription factor. Each of the RNA-binding domains specifically can bind solely to a single-stranded non-monotonous 5'-UUAG-3' sequence and also weaker to the single-stranded 5'-TTAGGG-3' telomeric DNA repeat. Binds RNA oligonucleotides with 5'-UUAGGG-3' repeats more tightly than the telomeric single-stranded DNA 5'-TTAGGG-3' repeats. Binding of RRM1 to DNA inhibits the formation of DNA quadruplex structure which may play a role in telomere elongation. May be involved in translationally coupled mRNA turnover. Implicated with other RNA-binding proteins in the cytoplasmic deadenylation/translational and decay interplay of the FOS mRNA mediated by the major coding-region determinant of instability (mCRD) domain. May play a role in the regulation of the rhythmic expression of circadian clock core genes. Directly binds to the 3' UTR of CRY1 mRNA and induces CRY1 rhythmic translation. May also be involved in the regulation of PER2 translation.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...