GnRH (GNRH1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen is a synthetic peptide directed towards the following sequence CSSQHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAETQRFECTTHQPRS
Specificity	Expected reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep Homology: Cow: 93%; Dog: 92%; Guinea Pig: 77%; Horse: 86%; Human: 100%; Mouse: 85%; Pig: 93%; Rabbit: 93%; Rat: 92%; Sheep: 86%
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.
Predicted Protein Size	10 kDa
Gene Name	gonadotropin releasing hormone 1
Database Link	NP_000816 Entrez Gene 2796 Human UniProt ID P01148
Background	The protein encoded by this gene is secreted and then cleaved to form the 10 aa luteinizing hormone-releasing hormone (LHRH, also known as gonadoliberin-1), and prolactin release-inhibiting factor (also known as GnRH-associated peptide 1). LHRH stimulates the release of luteinizing and follicle stimulating hormones, which are important for reproduction. Mutation in this gene are associated with hypogonadotropic hypogonadism. Alternatively spliced transcript variants have been described for this gene.
Synonyms	GNRH; GRH; LHRH; LNRH
Reference Data
Protein Families	Druggable Genome, Secreted Protein
Protein Pathways	GnRH signaling pathway

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.