C2 Rabbit Polyclonal Antibody
CNY 4,628.00
Cited in 1 publication. |
CNY 3,080.00
CNY 300.00
CNY 1,430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-C2 antibody: synthetic peptide directed towards the N terminal of human C2. Synthetic peptide located within the following region: EPICRQPYSYDFPEDVAPALGTSFSHMLGATNPTQKTKESLGRKIQIQRS |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 81 kDa |
Gene Name | complement component 2 |
Database Link | |
Background | Component C2 is part of the classical pathway of complement system. Activated C1 cleaves C2 into C2a and C2b. C2a leads to activation of C3. Deficiency of C2 has been reported to associated with certain autoimmune diseases.Component C2 is part of the classical pathway of complement system. Activated C1 cleaves C2 into C2a and C2b. C2a leads to activation of C3. Deficiency of C2 has been reported to associated with certain autoimmune diseases.Component C2 is part of the classical pathway of complement system. Activated C1 cleaves C2 into C2a and C2b. C2a leads to activation of C3. Deficiency of C2 has been reported to associated with certain autoimmune diseases. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
Synonyms | ARMD14; CO2 |
Note | Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Dog: 93%; Guinea pig: 93% |
Reference Data | |
Protein Families | Druggable Genome, Protease, Secreted Protein |
Protein Pathways | Complement and coagulation cascades, Systemic lupus erythematosus |
Citations (1)
The use of this Antibodies has been cited in the following citations: |
---|
CDKL5 controls postsynaptic localization of GluN2B-containing NMDA receptors in the hippocampus and regulates seizure susceptibility.
,null,
Neurobiology of disease
,PubMed ID 28688852
[C2]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |