ALLC Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ALLC antibody: synthetic peptide directed towards the N terminal of human ALLC. Synthetic peptide located within the following region: VIRGFDVDVSYFTGDYAPRVSIQAANLEEDKLPEIPERGTRTGAAATPEE
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	43 kDa
Gene Name	allantoicase
Database Link	NP_060906 Entrez Gene 55821 Human UniProt ID Q8N6M5
Background	Allantoicase (EC 3.5.3.4) participates in the uric acid degradation pathway. Its enzymatic activity, like that of urate oxidase (MIM 191540), was lost during vertebrate evolution.
Synonyms	ALC
Note	Immunogen Sequence Homology: Human: 100%; Dog: 85%; Rabbit: 85%; Horse: 83%; Bovine: 82%
Reference Data
Protein Pathways	Metabolic pathways, Purine metabolism

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.