BPGM Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-BPGM antibody: synthetic peptide directed towards the C terminal of human BPGM. Synthetic peptide located within the following region: LPTGVPILLELDENLRAVGPHQFLGDQEAIQAAIKKVEDQGKVKQAKK
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	28 kDa
Gene Name	bisphosphoglycerate mutase
Database Link	NP_001715 Entrez Gene 669 Human UniProt ID P07738
Background	BPGM belongs to the phosphoglycerate mutase family, BPG-dependent PGAM subfamily. It plays a major role in regulating hemoglobin oxygen affinity as a consequence of controlling 2,3-BPG concentration. It can also catalyze the reaction of EC 5.4.2.1 (mutase) and EC 3.1.3.13 (phosphatase), but with a reduced activity.
Synonyms	DPGM
Note	Immunogen Sequence Homology: Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 93%; Dog: 92%; Rat: 92%
Reference Data
Protein Families	Druggable Genome
Protein Pathways	Glycolysis / Gluconeogenesis, Metabolic pathways

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.