Cryptochrome I (CRY1) Rabbit Polyclonal Antibody
CNY 5,200.00
Cited in 2 publications. |
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
Specifications
Product Data | |
Applications | IHC, WB |
Recommend Dilution | WB, IHC |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-CRY1 antibody: synthetic peptide directed towards the N terminal of human CRY1. Synthetic peptide located within the following region: KRFQTLISKMEPLEIPVETITSEVIEKCTTPLSDDHDEKYGVPSLEELGF |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 64 kDa |
Gene Name | cryptochrome circadian clock 1 |
Database Link | |
Background | CRY1 is the blue light-dependent regulator of the circadian feedback loop. CRY1 inhibits CLOCK NPAS2-ARNTL E box-mediated transcription. CRY1 acts, in conjunction with CRY2, in maintaining period length and circadian rhythmicity. CRY1 has no photolyase activity. CRY1 is capable of translocating circadian clock core proteins such as PER proteins to the nucleus. CRY1 may inhibit CLOCK NPAS2-ARNTL transcriptional activity through stabilizing the unphosphorylated form of ARNTL. |
Synonyms | PHLL1 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Guinea pig: 100%; Rabbit: 93%; Zebrafish: 93% |
Reference Data | |
Protein Families | Druggable Genome |
Protein Pathways | Circadian rhythm - mammal |
Citations (2)
The use of this Antibodies has been cited in the following citations: |
---|
Class 3 PI3K coactivates the circadian clock to promote rhythmic de novo purine synthesis
,null,
Nature Cell Biology
,PubMed ID 37414850
[CRY1]
|
Autophagy Regulates the Liver Clock and Glucose Metabolism by Degrading CRY1
,Toledo, M;Batista-Gonzalez, A;Merheb, E;Aoun, ML;Tarabra, E;Feng, D;Sarparanta, J;Merlo, P;Botrè, F;Schwartz, GJ;Pessin, JE;Singh, R;,
Cell Metab.
,PubMed ID 29937374
[CRY1]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |
其它Cryptochrome I产品