CHST15 Rabbit Polyclonal Antibody
CAT#: TA341985
Rabbit Polyclonal Anti-GALNAC4S-6ST Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,200.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 9,998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-GALNAC4S-6ST antibody: synthetic peptide directed towards the middle region of human GALNAC4S-6ST. Synthetic peptide located within the following region: YDNSTDGEPPFLTQDFIHAFQPNARLIVMLRDPVERLYSDYLYFASSNKS |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 65 kDa |
Gene Name | carbohydrate (N-acetylgalactosamine 4-sulfate 6-O) sulfotransferase 15 |
Database Link | |
Background | Chondroitin sulfate (CS) is a glycosaminoglycan which is an important structural component ofThe extracellular matrix and which links to proteins to form proteoglycans. Chondroitin sulfate E (CS-E) is an isomer of chondroitin sulfate in whichThe C-4 and C-6 hydroxyl groups are sulfated.This gene encodes a type II transmembrane glycoprotein that acts as a sulfotransferase to transfer sulfate toThe C-6 hydroxal group of chondroitin sulfate.This gene has also been identified as being co-expressed with RAG1 in B-cells and as potentially acting as a B-cell surface signaling receptor. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Jul 2012] |
Synonyms | BRAG; GALNAC4S-6ST |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Bovine: 93%; Rabbit: 93% |
Reference Data | |
Protein Families | Transmembrane |
Protein Pathways | Chondroitin sulfate biosynthesis |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |