emopamil binding protein (EBP) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-EBP antibody: synthetic peptide directed towards the N terminal of human EBP. Synthetic peptide located within the following region: LVIEGWFVLYYEDLLGDQAFLSQLWKEYAKGDSRYILGDNFTVCMETITA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	26 kDa
Gene Name	emopamil binding protein (sterol isomerase)
Database Link	NP_006570 Entrez Gene 10682 Human UniProt ID Q15125
Background	The protein encoded byThis gene is an integral membrane protein ofThe endoplasmic reticulum. It is a high affinity binding protein forThe antiischemic phenylalkylamine Ca2+ antagonist [3H]emopamil andThe photoaffinity label [3H]azidopamil. It is similar to sigma receptors and may be a member of a superfamily of high affinity drug-binding proteins inThe endoplasmic reticulum of different tissues.This protein shares structural features with bacterial and eukaryontic drug transporting proteins. It has four putative transmembrane segments and contains two conserved glutamate residues which may be involved inThe transport of cationic amphiphilics. Another prominent feature ofThis protein is its high content of aromatic amino acid residues (>23%) in its transmembrane segments.These aromatic amino acid residues have been suggested to be involved inThe drug transport byThe P-glycoprotein. Mutations inThis gene cause Chondrodysplasia punctata 2 (CDPX2; also known as Conradi-Hunermann syndrome). [provided by RefSeq, Jul 2008]
Synonyms	CDPX2; CHO2; CPX; CPXD
Note	Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 86%; Rat: 85%; Mouse: 85%
Reference Data
Protein Families	Druggable Genome, Transmembrane
Protein Pathways	Metabolic pathways, Steroid biosynthesis

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.