ADAR1 (ADAR) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ADAR antibody: synthetic peptide directed towards the C terminal of human ADAR. Synthetic peptide located within the following region: RMGFTEVTPVTGASLRRTMLLLSRSPEAQPKTLPLTGSTFHDQIAMLSHR
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	136 kDa
Gene Name	adenosine deaminase, RNA-specific
Database Link	NP_001102 Entrez Gene 103 Human UniProt ID P55265
Background	This gene encodes a protein that sorts transmembrane proteins into lysosomes/vacuoles viaThe multivesicular body (MVB) pathway.This protein, along with other soluble coiled-coil containing proteins, forms part ofThe ESCRT-III protein complex that binds toThe endosomal membrane and recruits additional cofactors for protein sorting intoThe MVB.This protein may also co-immunoprecipitate with a member ofThe IFG-binding protein superfamily. Alternative splicing results in multiple transcript variants. Read-through transcription also exists betweenThis gene andThe upstream ring finger protein 103 (RNF103) gene. [provided by RefSeq, Nov 2010]
Synonyms	ADAR1; AGS6; DRADA; DSH; DSRAD; G1P1; IFI-4; IFI4; K88DSRBP; P136
Note	Immunogen Sequence Homology: Rat: 100%; Pig: 92%; Horse: 92%; Human: 92%; Rabbit: 92%; Guinea pig: 92%; Mouse: 91%
Reference Data
Protein Families	Druggable Genome
Protein Pathways	Cytosolic DNA-sensing pathway

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.