CLCA2 Rabbit Polyclonal Antibody
CAT#: TA338561
Rabbit Polyclonal Anti-CLCA2 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4,628.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-CLCA2 antibody: synthetic peptide directed towards the C terminal of human CLCA2. Synthetic peptide located within the following region: RYFFSFAANGRYSLKVHVNHSPSISTPAHSIPGSHAMYVPGYTANGNIQM |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 104 kDa |
Gene Name | chloride channel accessory 2 |
Database Link | |
Background | The protein encoded by this gene belongs to the calcium sensitive chloride conductance protein family. To date, all members of this gene family map to the same site on chromosome 1p31-p22 and share high degrees of homology in size, sequence and predicted structure, but differ significantly in their tissue distributions. Since this protein is expressed predominantly in trachea and lung, it is suggested to play a role in the complex pathogenesis of cystic fibrosis. It may also serve as adhesion molecule for lung metastatic cancer cells, mediating vascular arrest and colonization, and furthermore, it has been implicated to act as a tumor suppressor gene for breast cancer. [provided by RefSeq, Jul 2008] |
Synonyms | CACC; CaCC-3; CACC3; CLCRG2 |
Note | Immunogen Sequence Homology: Human: 100%; Bovine: 100%; Rat: 93%; Rabbit: 92%; Dog: 85%; Horse: 85%; Mouse: 79%; Pig: 77% |
Reference Data | |
Protein Families | Druggable Genome, Ion Channels: Other, Transmembrane |
Protein Pathways | Olfactory transduction |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |