Kv1.8 (KCNA10) Rabbit Polyclonal Antibody

CAT#: TA338556

Rabbit Polyclonal Anti-KCNA10 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4,381.00


货期*
2周

规格
    • 100 ug

Product images

经常一起买 (2)
Transient overexpression lysate of potassium voltage-gated channel, shaker-related subfamily, member 10 (KCNA10)
    • 100 ug

CNY 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00

Specifications

Product Data
Applications IHC, WB
Recommend Dilution WB, IHC
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-KCNA10 antibody: synthetic peptide directed towards the middle region of human KCNA10. Synthetic peptide located within the following region: PANVPIDIFADEISFYELGSEAMDQFREDEGFIKDPETLLPTNDIHRQFW
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 56 kDa
Gene Name potassium voltage-gated channel subfamily A member 10
Background Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. It is specifically regulated by cGMP and postulated to mediate the effects of substances that increase intracellular cGMP. This gene is intronless, and the gene is clustered with genes KCNA2 and KCNA3 on chromosome 1. [provided by RefSeq, Jul 2008]
Synonyms Kcn1; Kv1.8
Note Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Dog: 92%; Pig: 92%; Guinea pig: 92%
Reference Data
Protein Families Druggable Genome, Ion Channels: Potassium, Transmembrane
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...