MVB12B Rabbit Polyclonal Antibody
CAT#: TA335418
Rabbit Polyclonal Anti-MVB12B Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4,628.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-MVB12B Antibody is: synthetic peptide directed towards the C-terminal region of Human MVB12B. Synthetic peptide located within the following region: HISLTLPATFRGRNSTRTDYEYQHSNLYAISAMDGVPFMISEKFSCVPES |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 35 kDa |
Gene Name | multivesicular body subunit 12B |
Database Link | |
Background | The protein encoded by this gene is a component of the ESCRT-I complex, a heterotetramer, which mediates the sorting of ubiquitinated cargo protein from the plasma membrane to the endosomal vesicle. ESCRT-I complex plays an essential role in HIV budding and endosomal protein sorting. Depletion and overexpression of this and related protein (MVB12A) inhibit HIV-1 infectivity and induce unusual viral assembly defects, indicating a role for MVB12 subunits in regulating ESCRT-mediated virus budding. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
Synonyms | C9orf28; FAM125B |
Note | Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Guinea pig: 100%; Dog: 93%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Mouse: 85% |
Reference Data | |
Protein Pathways | Endocytosis |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |