SCN3B Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SCN3B antibody: synthetic peptide directed towards the N terminal of human SCN3B. Synthetic peptide located within the following region: RPEGGKDFLIYEYRNGHQEVESPFQGRLQWNGSKDLQDVSITVLNVTLND
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	24 kDa
Gene Name	sodium voltage-gated channel beta subunit 3
Database Link	NP_060870 Entrez Gene 55800 Human UniProt ID Q9NY72
Background	SCN3B is one member of the sodium channel beta subunits of voltage-gated sodium channels, which are responsible for the generation and propagation of action potentials in neurons and muscle. SCN3B influences the inactivation kinetics of the sodium channel.
Synonyms	ATFB16; BRGDA7; HSA243396; SCNB3
Note	Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Guinea pig: 93%
Reference Data
Protein Families	Druggable Genome, Ion Channels: Sodium, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.