SHC4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-SHC4 antibody is: synthetic peptide directed towards the N-terminal region of Human SHC4. Synthetic peptide located within the following region: NPATLLSLKNFCLGTKEVPRLKLQESRDPGSSGPSSPETSLSRSGTAPPP
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	69 kDa
Gene Name	SHC adaptor protein 4
Database Link	NP_976224 Entrez Gene 399694 Human UniProt ID Q6S5L8
Background	SHC4 activates both Ras-dependent and Ras-independent migratory pathways in melanomas. It contributes to the early phases of agrin-induced tyrosine phosphorylation of CHRNB1.
Synonyms	RaLP; SHCD
Note	Human: 100%
Reference Data
Protein Pathways	Chemokine signaling pathway, Chronic myeloid leukemia, ErbB signaling pathway, Focal adhesion, Glioma, Insulin signaling pathway, Natural killer cell mediated cytotoxicity, Neurotrophin signaling pathway

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.