GMPPA Rabbit Polyclonal Antibody

CAT#: TA331024

Rabbit polyclonal Anti-GMPPA Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4,628.00


货期*
2周

规格
    • 50 ug

Product images

经常一起买 (4)
Transient overexpression lysate of GDP-mannose pyrophosphorylase A (GMPPA), transcript variant 2
    • 100 ug

CNY 4,840.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human GDP-mannose pyrophosphorylase A (GMPPA), transcript variant 2, 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Recombinant protein of human GDP-mannose pyrophosphorylase A (GMPPA), transcript variant 2, 100 µg
    • 100 ug

CNY 9,998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-GMPPA antibody: synthetic peptide directed towards the N terminal of human GMPPA. Synthetic peptide located within the following region: LKAVILIGGPQKGTRFRPLSFEVPKPLFPVAGVPMIQHHIEACAQVPGMQ
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 46 kDa
Gene Name GDP-mannose pyrophosphorylase A
Background GMPPA is a GDP-mannose pyrophosphorylase. This enzyme catalyzes the reaction which converts mannose-1-phosphate and GTP to GDP-mannose which is involved in the production of N-linked oligosaccharides.This gene is thought to encode a GDP-mannose pyrophosphorylase. This enzyme catalyzes the reaction which converts mannose-1-phosphate and GTP to GDP-mannose which is involved in the production of N-linked oligosaccharides.
Synonyms AAMR
Note Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Yeast: 92%
Reference Data
Protein Pathways Amino sugar and nucleotide sugar metabolism, Fructose and mannose metabolism, Metabolic pathways
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...