CREB5 Rabbit Polyclonal Antibody
CAT#: TA330056
Rabbit Polyclonal Anti-CREB5 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4,537.00
CNY 300.00
CNY 1,430.00
CNY 3,080.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-CREB5 antibody: synthetic peptide directed towards the N terminal of human CREB5. Synthetic peptide located within the following region: CSLEHEFRKAQEEESSKRNISMHNAVGGAMTGPGTHQLSSARLPNHDTNV |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 53 kDa |
Gene Name | cAMP responsive element binding protein 5 |
Database Link | |
Background | CREB5 belongs to the CRE (cAMP response element)-binding protein family. Members of this family contain zinc-finger and bZIP DNA-binding domains. This protein specifically binds to CRE as a homodimer or a heterodimer with c-Jun or CRE-BP1, and functions as a CRE-dependent trans-activator. Alternatively spliced transcript variants encoding different isoforms have been identified. |
Synonyms | CRE-BPA; CREB-5 |
Note | Immunogen sequence homology: Dog: 100%; Horse: 100%; Human: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Mouse: 92%; Chicken: 85%; Guinea pig: 85% |
Reference Data | |
Protein Families | Transcription Factors |
Protein Pathways | Huntington's disease, Prostate cancer |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |