Wnt1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Wnt1 antibody is: synthetic peptide directed towards the C-terminal region of MOUSE Wnt1. Synthetic peptide located within the following region: NFCTYSGRLGTAGTAGRACNSSSPALDGCELLCCGRGHRTRTQRVTERCN
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	40 kDa
Gene Name	wingless-type MMTV integration site family, member 1
Database Link	NP_067254 Entrez Gene 22408 Mouse UniProt ID P04426
Background	Wnt1 is a ligand for members of the frizzled family of seven transmembrane receptors. In some developmental processes, it is also a ligand for the coreceptor RYK, thus triggering Wnt signaling. It is a probable developmental protein and may be a signaling molecule important in CNS development. Wnt1 is likely to signal over only few cell diameters. It ha s a proeminent role in the induction of the mesencephalon and cerebellum. It may play a crucial role in the morphogenesis of the neural tube and/or the early stages of CNS development. It has a role in osteoblast function and bone development.
Synonyms	INT1
Note	Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.