Gjb3 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Gjb3 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: MDWKKLQDLLSGVNQYSTAFGRIWLSVVFVFRVLVYVVAAERVWGDEQKD
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	31 kDa
Gene Name	gap junction protein, beta 3
Database Link	NP_032152 Entrez Gene 14620 Mouse UniProt ID P28231
Background	One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell.
Synonyms	Connexin-31; CX31; DFNA2; DFNA2B; EKV; FLJ22486; MGC102938
Note	Immunogen sequence homology: Rat: 100%; Mouse: 100%; Zebrafish: 92%; Dog: 83%; Pig: 83%; Horse: 83%; Human: 83%; Bovine: 79%; Rabbit: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.