RAD17 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human, Mouse, Xenopus
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-RAD17 antibody: synthetic peptide directed towards the N terminal of human RAD17. Synthetic peptide located within the following region: MNQVTDWVDPSFDDFLECSGVSTITATSLGVNNSSHRRKNGPSTLESSRF
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	76 kDa
Gene Name	RAD17 checkpoint clamp loader component
Database Link	NP_002864 Entrez Gene 19356 MouseEntrez Gene 5884 Human UniProt ID O75943
Background	RAD17 is highly similar to the gene product of Schizosaccharomyces pombe rad17, a cell cycle checkpoint gene required for cell cycle arrest and DNA damage repair in response to DNA damage. This protein shares strong similarity with DNA replication factor C (RFC), and can form a complex with RFCs. This protein binds to chromatin prior to DNA damage and is phosphorylated by ATR after the damage. This protein recruits the RAD1-RAD9-HUS1 checkpoint protein complex onto chromatin after DNA damage, which may be required for its phosphorylation.
Synonyms	CCYC; HRAD17; R24L; RAD17SP; RAD24
Note	Immunogen sequence homology: Dog: 100%; Pig: 100%; Human: 100%; Rabbit: 100%; Horse: 92%; Rat: 89%; Bovine: 89%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.