GCDH Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Gcdh Antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: LQLGRLKDQDKATPEMVSLLKRNNCGKALDIARQARDILGGNGISDEYHV
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	49 kDa
Gene Name	glutaryl-CoA dehydrogenase
Database Link	NP_039663 Entrez Gene 364975 Rat UniProt ID Q92947
Background	The function of this protein remains unknown.
Synonyms	ACAD5; GCD
Note	Immunogen sequence homology: Human: 100%; Bovine: 100%; Dog: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Rabbit: 92%; Pig: 86%; Guinea pig: 85%; Zebrafish: 79%
Reference Data
Protein Families	Druggable Genome
Protein Pathways	Fatty acid metabolism, Lysine degradation, Metabolic pathways, Tryptophan metabolism

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.