C7orf30 (MALSU1) (NM_138446) Human Mass Spec Standard
CAT#: PH304263
C7orf30 MS Standard C13 and N15-labeled recombinant protein (NP_612455)
View other "C7orf30" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
Specifications
Product Data | |
Description | C7orf30 MS Standard C13 and N15-labeled recombinant protein (NP_612455) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204263 |
Predicted MW | 26.2 kDa |
Protein Sequence |
>RC204263 protein sequence
Red=Cloning site Green=Tags(s) MGPGGRVARLLAPLMWRRAVSSVAGSAVGAEPGLRLLAVQRLPVGAAFCRACQTPNFVRGLHSEPGLEER AEGTVNEGRPESDAADHTGPKFDIDMMVSLLRQENARDICVIQVPPEMRYTDYFVIVSGTSTRHLHAMAF YVVKMYKHLKCKRDPHVKIEGKDTDDWLCVDFGSMVIHLMLPETREIYELEKLWTLRSYDDQLAQIAPET VPEDFILGIEDDTSSVTPVELKCE myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_612455 |
RefSeq Size | 774 |
RefSeq ORF | 702 |
Synonyms | C7orf30; mtRsfA |
Locus ID | 115416 |
Cytogenetics | 7p15.3 |
Summary | Required for normal mitochondrial ribosome function and mitochondrial translation (PubMed:22238375, PubMed:23171548). May play a role in ribosome biogenesis by preventing premature association of the 28S and 39S ribosomal subunits (Probable). Interacts with mitochondrial ribosomal protein L14 (MRPL14), probably blocking formation of intersubunit bridge B8, preventing association of the 28S and 39S ribosomal subunits (Probable). Addition to isolated mitochondrial ribosomal subunits partially inhibits translation, probably by interfering with the association of the 28S and 39S ribosomal subunits and the formation of functional ribosomes (Probable). May also participate in the assembly and/or regulation of the stability of the large subunit of the mitochondrial ribosome (PubMed:22238376, PubMed:23171548). May function as a ribosomal silencing factor (Probable).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408597 | MALSU1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY408597 | Transient overexpression lysate of chromosome 7 open reading frame 30 (C7orf30) |
CNY 3080.00 |
|
TP304263 | Recombinant protein of human chromosome 7 open reading frame 30 (C7orf30), 20 µg |
CNY 2900.00 |
其它C7orf30产品