RPP20 (POP7) (NM_005837) Human Mass Spec Standard
CAT#: PH300582
POP7 MS Standard C13 and N15-labeled recombinant protein (NP_005828)
View other "RPP20" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | POP7 MS Standard C13 and N15-labeled recombinant protein (NP_005828) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200582 |
| Predicted MW | 15.7 kDa |
| Protein Sequence |
>RC200582 protein sequence
Red=Cloning site Green=Tags(s) MAENREPRGAVEAELDPVEYTLRKRLPSRLPRRPNDIYVNMKTDFKAQLARCQKLLDGGARGQNACSEIY IHGLGLAINRAINIALQLQAGSFGSLQVAANTSTVELVDELEPETDTREPLTRIRNNSAIHIRVFRVTPK SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_005828 |
| RefSeq Size | 949 |
| RefSeq ORF | 420 |
| Synonyms | 0610037N12Rik; RPP2; RPP20 |
| Locus ID | 10248 |
| Cytogenetics | 7q22.1 |
| Summary | Component of ribonuclease P, a ribonucleoprotein complex that generates mature tRNA molecules by cleaving their 5'-ends (PubMed:9630247, PubMed:30454648). Also a component of the MRP ribonuclease complex, which cleaves pre-rRNA sequences (PubMed:28115465).[UniProtKB/Swiss-Prot Function] |
| Protein Families | Stem cell - Pluripotency |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC417024 | POP7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY417024 | Transient overexpression lysate of processing of precursor 7, ribonuclease P/MRP subunit (S. cerevisiae) (POP7) |
CNY 3080.00 |
|
| TP300582 | Recombinant protein of human processing of precursor 7, ribonuclease P/MRP subunit (S. cerevisiae) (POP7), 20 µg |
CNY 2900.00 |
