USP38 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-USP38 antibody: synthetic peptide directed towards the middle region of human USP38. Synthetic peptide located within the following region: LVNKDVPQKPGGETTPSVTDLLNYFLAPEILTGDNQYYCENCASLQNAEK
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	116 kDa
Gene Name	ubiquitin specific peptidase 38
Database Link	NP_115946 Entrez Gene 84640 Human UniProt ID Q8NB14
Background	The function of USP38 remians unknown.
Synonyms	HP43.8KD
Note	Immunogen Sequence Homology: Pig: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Horse: 93%; Guinea pig: 93%; Dog: 86%; Rat: 85%; Mouse: 83%
Reference Data
Protein Families	Druggable Genome, Protease

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.