C16orf73 (MEIOB) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-C16orf73 antibody: synthetic peptide directed towards the middle region of human C16orf73. Synthetic peptide located within the following region: CSLTGSVAEETLGCTFVLSHRARSGLKISVLSCKLADPTEASRNLSGQKH
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	22 kDa
Gene Name	meiosis specific with OB domains
Database Link	NP_689977 Entrez Gene 254528 Human UniProt ID Q8N635
Background	The function of this protein remains unknown.
Synonyms	C16orf73; gs129
Note	Immunogen sequence homology: Human: 100%; Rat: 92%; Horse: 92%; Dog: 91%; Pig: 86%; Guinea pig: 86%; Bovine: 83%; Mouse: 79%; Rabbit: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.